CAZyme Information

Basic Information
SpeciesAquilegia coerulea
Cazyme IDAquca_094_00019.3
FamilyGT77
Protein PropertiesLength: 468 Molecular Weight: 53166 Isoelectric Point: 8.0185
ChromosomeChromosome/Scaffold: 94 Start: 450769 End: 456538
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT772234434.2039e-45
  ISNFVICALDDEVYQFSVLQGLPVFKDAFAPSDISFNDCHFGTKCFQRVTKVKSRIVLQILKMGYNILLSDVDVYWFYNPLPLVGSFGPGVFVAQSDEYN
  ETGPINMPRRLNSGFYFAHSDKITIAAMEKVVLHASVSDLSEQPSFYDVMCGEGGANRLGDDKCLEPETNLTVHFLDRNLFPNGAYQGLWEKENVKEACN
  MKGCIILHNNWISGRKKKLER
Full Sequence
Protein Sequence     Length: 468     Download
MLMAWNTGEL PLHAGVLPPF LYAKGIHNQW IINEALSSDF RFVFDVSGAI SSFYANELGH    60
WPNQFVKGSD FEDAKNKSWE YMANSHLGSL YGSLYFRGAN FSSKLVKLVK CDGHYHFFDT    120
AENVASPYRD YGSLSLWKGR ILRSRREKKW KKCVEGIKSM DKNMDCSFKE SFDISTPVVL    180
PLSLEALLST VVGKDRTIML AIAGNSYRDM LLSWVCRLRQ LQISNFVICA LDDEVYQFSV    240
LQGLPVFKDA FAPSDISFND CHFGTKCFQR VTKVKSRIVL QILKMGYNIL LSDVDVYWFY    300
NPLPLVGSFG PGVFVAQSDE YNETGPINMP RRLNSGFYFA HSDKITIAAM EKVVLHASVS    360
DLSEQPSFYD VMCGEGGANR LGDDKCLEPE TNLTVHFLDR NLFPNGAYQG LWEKENVKEA    420
CNMKGCIILH NNWISGRKKK LERQLSSGLF EYDVSTRMCL HRWHKTK*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans5.0e-46223444223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52325.10146092535AC011663_4 hypothetical protein; 72471-70598 [Arabidopsis thaliana]
EMBLCAN65937.10146786541hypothetical protein [Vitis vinifera]
RefSeqNP_177220.20146094537unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.10146793558PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.10146293552predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL3424482552114650
EX1364522361774120
EL3544682841774600
EH6740232531484000
GO9564462272384640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny