| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_718_00001.2 |
| Family | GT33 |
| Protein Properties | Length: 105 Molecular Weight: 11579.3 Isoelectric Point: 6.768 |
| Chromosome | Chromosome/Scaffold: 718 Start: 5602 End: 7445 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT33 | 1 | 104 | 3.9e-21 |
| MADGALCVTRAMQHELAEKWGITATVLYDHPPEFFHPASLEEKYKLFCRLKKNIIYPYGIRDCVSMGTMGTSTSDSNDTLFTTQVGTEISLKMNRPAIIV SSTS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 105 Download |
| MADGALCVTR AMQHELAEKW GITATVLYDH PPEFFHPASL EEKYKLFCRL KKNIIYPYGI 60 RDCVSMGTMG TSTSDSNDTL FTTQVGTEIS LKMNRPAIIV SSTS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR04047 | MSMEG_0565_glyc | 0.005 | 2 | 26 | 25 | + glycosyltransferase, MSMEG_0565 family. A conserved gene cluster found sporadically from Actinobacteria to Proteobacteria to Cyanobacteria features a radical SAM protein, an N-acetyltransferase, an oxidoreductase, and two additional proteins whose functional classes are unclear. The metabolic role of the cluster is probably biosynthetic. This glycosyltransferase, named from member MSMEG_0565 from Mycobacterium smegmatis, occurs in most but not all instances of the cluster [Unknown function, Enzymes of unknown specificity]. | ||
| cd03816 | GT1_ALG1_like | 4.0e-21 | 1 | 104 | 106 | + This family is most closely related to the GT1 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik. | ||
| PLN02275 | PLN02275 | 9.0e-25 | 1 | 104 | 104 | + transferase, transferring glycosyl groups | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI19390.1 | 1e-39 | 2 | 104 | 175 | 277 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_173105.1 | 1e-33 | 1 | 104 | 165 | 265 | glycosyl transferase family 1 protein [Arabidopsis thaliana] |
| RefSeq | XP_002283369.1 | 2e-39 | 2 | 104 | 290 | 392 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002330745.1 | 3e-40 | 1 | 104 | 166 | 269 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002532170.1 | 6e-37 | 1 | 104 | 170 | 270 | beta1,4 mannosyltransferase, putative [Ricinus communis] |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DT763576 | 105 | 1 | 105 | 0 |
| DR940879 | 104 | 1 | 104 | 2.94273e-44 |
| JZ015604 | 89 | 1 | 89 | 3.00018e-42 |
| FN008489 | 104 | 1 | 104 | 1.99993e-41 |
| AM781509 | 104 | 1 | 104 | 9.99995e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
