Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra000314 |
Family | GH19 |
Protein Properties | Length: 260 Molecular Weight: 27760.9 Isoelectric Point: 9.9771 |
Chromosome | Chromosome/Scaffold: 03 Start: 10506049 End: 10507147 |
Description | Chitinase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 66 | 259 | 0 |
IASVVTPAFFNGIMSKVGRGCPAKGFYTRQAFIAAAQSFAAYKGTVAKREIAAMLAQFSHESGSFCYKEEIARGRYCSPSTTYPCQPGKNYYGRGPIQIT WNYNYGAAGKFLGLPLLKDPDMVARSPTVAFKCAMWFWNKNVRPVLSRGFGATTRRINGGECDGGRPAAVQSRVNHYLDFCKKLGVTPGTNLKC |
Full Sequence |
---|
Protein Sequence Length: 260 Download |
MTETAFSRNC GKTGCKGNMC CSRWGYCGTN AYCGTGCQSG PCKSKPKPTP TPSGSGGLNA 60 GPRGTIASVV TPAFFNGIMS KVGRGCPAKG FYTRQAFIAA AQSFAAYKGT VAKREIAAML 120 AQFSHESGSF CYKEEIARGR YCSPSTTYPC QPGKNYYGRG PIQITWNYNY GAAGKFLGLP 180 LLKDPDMVAR SPTVAFKCAM WFWNKNVRPV LSRGFGATTR RINGGECDGG RPAAVQSRVN 240 HYLDFCKKLG VTPGTNLKC* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00035 | ChtBD1 | 8.0e-5 | 7 | 38 | 33 | + Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. | ||
COG3179 | COG3179 | 5.0e-10 | 109 | 225 | 153 | + Predicted chitinase [General function prediction only] | ||
cd00442 | lysozyme_like | 6.0e-11 | 117 | 220 | 104 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
pfam00182 | Glyco_hydro_19 | 6.0e-66 | 69 | 259 | 232 | + Chitinase class I. | ||
cd00325 | chitinase_glyco_hydro_19 | 4.0e-81 | 70 | 259 | 230 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0008061 | chitin binding |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_176061.1 | 0 | 1 | 259 | 22 | 280 | glycoside hydrolase family 19 protein [Arabidopsis thaliana] |
RefSeq | NP_181887.1 | 0 | 1 | 259 | 18 | 264 | chitinase, putative [Arabidopsis thaliana] |
RefSeq | NP_181888.1 | 0 | 1 | 259 | 16 | 273 | glycoside hydrolase family 19 protein [Arabidopsis thaliana] |
RefSeq | NP_181889.1 | 0 | 1 | 259 | 22 | 281 | glycoside hydrolase family 19 protein [Arabidopsis thaliana] |
RefSeq | NP_181890.1 | 0 | 1 | 259 | 22 | 283 | chitinase, putative [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 0 | 65 | 259 | 1 | 204 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3hbe_X | 0 | 65 | 259 | 1 | 204 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3hbd_A | 0 | 65 | 259 | 1 | 204 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 4dyg_B | 0 | 65 | 259 | 2 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 4dyg_A | 0 | 65 | 259 | 2 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EW716239 | 261 | 1 | 260 | 0 |
FY439963 | 261 | 1 | 260 | 0 |
JZ151778 | 261 | 1 | 258 | 0 |
ES909239 | 238 | 1 | 237 | 0 |
JZ151778 | 24 | 237 | 260 | 0.0003 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|