| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra002720 |
| Family | GH16 |
| Protein Properties | Length: 215 Molecular Weight: 24385.4 Isoelectric Point: 7.2843 |
| Chromosome | Chromosome/Scaffold: 10 Start: 8014043 End: 8014765 |
| Description | Xyloglucan endotransglucosylase/hydrolase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 2 | 133 | 3.8e-22 |
| QMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFHTYTILWNPQRIIFTVDGTPIREFKNMESVG TLFPKNQPMRMYSSLWNADDWATRGGLVKTDW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 215 Download |
| MQMKLVPGNS AGTVTTLYLK SPGTTWDEID FEFLGNLSGD PYTLHTNVYT QGKGDKEQQF 60 KLWFDPTADF HTYTILWNPQ RIIFTVDGTP IREFKNMESV GTLFPKNQPM RMYSSLWNAD 120 DWATRGGLVK TDWSKAPFTA SYRGFNQEAC VWSNGKSSCP NGSGQGPTGS WLSQELDSTA 180 QERMRWVQKN YMIYNYCTDT KRFPQGLPKE CFAA* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam06955 | XET_C | 1.0e-21 | 166 | 211 | 49 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 8.0e-23 | 2 | 143 | 157 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 1.0e-60 | 1 | 135 | 137 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 1.0e-95 | 1 | 212 | 215 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 1.0e-125 | 1 | 211 | 212 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL32550.1 | 0 | 1 | 214 | 73 | 286 | xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana] |
| EMBL | CAD87535.1 | 0 | 1 | 211 | 71 | 280 | putative xyloglucan endotransglycosylase [Cucumis sativus] |
| EMBL | CAD87536.1 | 0 | 1 | 211 | 76 | 287 | putative xyloglucan endotransglycosylase [Cucumis sativus] |
| RefSeq | NP_194311.1 | 0 | 1 | 214 | 73 | 286 | XTR6 (XYLOGLUCAN ENDOTRANSGLYCOSYLASE 6); hydrolase, acting on glycosyl bonds / hydrolase, hydrolyzing O-glycosyl compounds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] |
| RefSeq | NP_200564.1 | 0 | 1 | 214 | 70 | 284 | TCH4 (Touch 4); hydrolase, acting on glycosyl bonds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 211 | 64 | 272 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1un1_A | 0 | 1 | 211 | 64 | 272 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1umz_B | 0 | 1 | 211 | 64 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 211 | 64 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 0 | 3 | 211 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EX127446 | 215 | 1 | 215 | 0 |
| EX134696 | 215 | 1 | 215 | 0 |
| EX126572 | 215 | 1 | 215 | 0 |
| EX132594 | 215 | 1 | 215 | 0 |
| EX132111 | 215 | 1 | 215 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
