| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra002982 |
| Family | AA6 |
| Protein Properties | Length: 205 Molecular Weight: 21772 Isoelectric Point: 7.8042 |
| Chromosome | Chromosome/Scaffold: 10 Start: 6298435 End: 6299541 |
| Description | flavodoxin-like quinone reductase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA6 | 4 | 198 | 0 |
| KVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALLKMSAPPKSGSPIITPNDLTEADGFVLGFPTRFGMMAAQVKAFLDATGGLWRTQ ALAGKPAGIFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTQLELEQAFHQGKYIATITKK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 205 Download |
| MATKVYIVYY SMYGHVEKLA EEIRKGAASV EGVEAKLWQV PETLPEEALL KMSAPPKSGS 60 PIITPNDLTE ADGFVLGFPT RFGMMAAQVK AFLDATGGLW RTQALAGKPA GIFYSTGSQG 120 GGQETTALTA ITQLVHHGMI FVPIGYTFGA GMFEMEKVKG GSPYGAGTFA GDGSRQPTQL 180 ELEQAFHQGK YIATITKKLK VSTV* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00258 | Flavodoxin_1 | 8.0e-10 | 7 | 113 | 117 | + Flavodoxin. | ||
| pfam03358 | FMN_red | 2.0e-10 | 17 | 146 | 134 | + NADPH-dependent FMN reductase. | ||
| COG0655 | WrbA | 6.0e-35 | 1 | 200 | 207 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
| TIGR01755 | flav_wrbA | 1.0e-60 | 3 | 199 | 198 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
| PRK03767 | PRK03767 | 3.0e-73 | 3 | 200 | 199 | + NAD(P)H:quinone oxidoreductase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0009055 | electron carrier activity |
| GO:0010181 | FMN binding |
| GO:0016491 | oxidoreductase activity |
| GO:0050662 | coenzyme binding |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK94567.1 | 0 | 1 | 200 | 1 | 200 | unknown [Populus trichocarpa] |
| RefSeq | NP_200261.1 | 0 | 1 | 203 | 1 | 203 | FQR1 (FLAVODOXIN-LIKE QUINONE REDUCTASE 1); FMN binding / oxidoreductase, acting on NADH or NADPH, quinone or similar compound as acceptor [Arabidopsis thaliana] |
| RefSeq | XP_002283286.1 | 0 | 1 | 200 | 1 | 200 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002319258.1 | 0 | 1 | 200 | 1 | 200 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002534445.1 | 0 | 1 | 202 | 1 | 202 | Minor allergen Alt a, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3b6m_B | 0 | 4 | 200 | 3 | 197 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| PDB | 3b6m_A | 0 | 4 | 200 | 3 | 197 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| PDB | 3b6k_B | 0 | 4 | 200 | 3 | 197 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| PDB | 3b6k_A | 0 | 4 | 200 | 3 | 197 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| PDB | 3b6j_B | 0 | 4 | 200 | 3 | 197 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FY064643 | 205 | 1 | 205 | 0 |
| FY067814 | 205 | 1 | 205 | 0 |
| FY067750 | 205 | 1 | 205 | 0 |
| FY072392 | 205 | 1 | 205 | 0 |
| DK507238 | 205 | 1 | 205 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
