CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra005218
FamilyGT43
Protein PropertiesLength: 348 Molecular Weight: 39356.1 Isoelectric Point: 9.7051
ChromosomeChromosome/Scaffold: 05 Start: 4077289 End: 4078738
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT431333380
  MANTLRLVPPPLLWIVVEKHSEADVNSSSTMLRKTGLMYRRIVFKENFTSLEAELDHQRNLALRHIEHHKLSGIVHFAGLNNIYDLDFFDEIRDIEVFGT
  WPMALLSANRKRVIVEGPVCESSQVLGWHLRKINNETETKPPVHISSFAFNSSILWDPERWGRPSSVEGTKQDSIKYVKQVVLEDDTKLKGLPAQDCSKV
  MLWRLN
Full Sequence
Protein Sequence     Length: 348     Download
MGSLERSKKK TQVWKKAVIH FSLCFVMGFF TGFAPAGKAS LFSNFETTPS TTSKSQIPPH    60
PSENSTYTPN SLADKALVSS QVQAPSPSKS QEAEPENRSL SETEEEVTPR GLVIVVTPVM    120
TKDRYKNVLL RRMANTLRLV PPPLLWIVVE KHSEADVNSS STMLRKTGLM YRRIVFKENF    180
TSLEAELDHQ RNLALRHIEH HKLSGIVHFA GLNNIYDLDF FDEIRDIEVF GTWPMALLSA    240
NRKRVIVEGP VCESSQVLGW HLRKINNETE TKPPVHISSF AFNSSILWDP ERWGRPSSVE    300
GTKQDSIKYV KQVVLEDDTK LKGLPAQDCS KVMLWRLNFP TRTRFST*                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03360Glyco_transf_433.0e-72133341223+
cd00218GlcAT-I1.0e-88112341235+
PLN02458PLN0245801346351+
Gene Ontology
GO TermDescription
GO:0015018galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX33319.1013411341secondary cell wall-related glycosyltransferase family 43 [Populus tremula x Populus tremuloides]
GenBankABP65661.1013411341secondary wall-associated glycosyltransferase family 43B [Populus tremula x Populus alba]
EMBLCAI93178.1013401341glycosyltransferase [Populus balsamifera]
RefSeqNP_181246.1013471351IRX9 (IRREGULAR XYLEM 9); transferase, transferring glycosyl groups / xylosyltransferase [Arabidopsis thaliana]
RefSeqXP_002323456.1013411342glycosyl transferase [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1v84_B0.0000000000071153357229A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1v84_A0.0000000000071153357229A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1v83_B0.0000000000071153357229A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1v83_A0.0000000000071153357229A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1v82_B0.0000000000071153357229A Chain A, Crystal Structure Of Human Glcat-P Apo Form
Transmembrane Domains
StartEnd
1736
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EW7367422401093480
EW73210124712470
EV1295582251243480
FD97831323392410
EX905046225182420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00731.2Aquca_007_00731.1Aquca_001_00368.3Aquca_001_00368.2Aquca_001_00368.1
Aquca_010_00019.1Aquca_027_00094.1
Arabidopsis lyrata912627496876890287902844
Arabidopsis thalianaAT5G67230.1AT4G36890.1AT1G27600.2AT1G27600.1AT2G37090.1
Brachypodium distachyonBradi1g33320.3Bradi1g33320.2Bradi1g33320.1Bradi5g24290.1Bradi3g23120.1
Bradi2g00290.1Bradi5g02350.1Bradi2g46410.1Bradi2g16840.1Bradi1g16540.1
Bradi1g65750.1Bradi1g16540.2Bradi2g37970.3Bradi2g37970.1
Brassica rapaBra012145Bra011745Bra010929Bra030055
Carica papayaevm.model.supercontig_55.103evm.model.supercontig_7.258evm.model.supercontig_366.2evm.model.supercontig_286.11
Capsella rubellaCarubv10004588mCarubv10027753mCarubv10009365mCarubv10025381mCarubv10025384m
Citrus clementinaCiclev10025401mCiclev10008306mCiclev10008305mCiclev10008303mCiclev10001397m
Ciclev10012036m
Citrus sinensisorange1.1g013985morange1.1g010452morange1.1g013438morange1.1g013414morange1.1g016070m
orange1.1g016052morange1.1g042066m
Cucumis sativusCucsa.102610.2Cucsa.102610.1Cucsa.312290.4Cucsa.312610.1Cucsa.312290.3
Cucsa.312290.2Cucsa.312290.1.175.269Cucsa.312290.1.175.269Cucsa.307090.2Cucsa.307090.1
Cucsa.312290.1.357.476Cucsa.312290.1.357.476
Eucalyptus grandisEucgr.I00880.2Eucgr.I00880.1Eucgr.H02219.1Eucgr.C00584.1Eucgr.F00463.3
Eucgr.F00463.2Eucgr.F00463.1Eucgr.F02177.3Eucgr.F02177.2Eucgr.F02177.1
Eucgr.A01172.1Eucgr.K03214.1
Fragaria vescamrna23860.1-v1.0-hybridmrna09635.1-v1.0-hybridmrna08813.1-v1.0-hybridmrna26845.1-v1.0-hybrid
Glycine maxGlyma17g18450.2Glyma17g18450.1Glyma16g16280.1Glyma11g05640.1Glyma01g39610.1
Glyma05g20910.2Glyma06g08820.1Glyma04g08720.2Glyma04g08720.1Glyma03g33570.1
Glyma19g36280.1Glyma10g05730.2Glyma10g05730.1Glyma13g20080.1Glyma13g20080.2
Glyma06g09560.1Glyma04g09470.2
Gossypium raimondiiGorai.007G216800.2Gorai.007G216800.1Gorai.003G026800.1Gorai.004G051000.1Gorai.004G051100.1
Gorai.004G290300.4Gorai.004G290300.3Gorai.004G290300.2Gorai.004G290300.1Gorai.009G051500.3
Gorai.009G051500.2Gorai.009G051500.1Gorai.005G097300.3Gorai.005G097300.2Gorai.005G097300.1
Gorai.002G137600.1Gorai.006G168500.1Gorai.010G031000.2Gorai.010G031000.1Gorai.006G168500.2
Linum usitatissimumLus10010268Lus10041601Lus10011500Lus10019325Lus10032817
Lus10007692Lus10019917Lus10026487Lus10015069
Malus domesticaMDP0000186002MDP0000308871MDP0000207693MDP0000287243MDP0000666177
MDP0000703247MDP0000259253MDP0000487987MDP0000131594MDP0000126039
MDP0000130817
Manihot esculentacassava4.1_006028mcassava4.1_006067mcassava4.1_008517mcassava4.1_007765mcassava4.1_008594m
cassava4.1_031170mcassava4.1_029083m
Medicago truncatulaMedtr5g016600.1AC225517_17.1Medtr3g111060.1Medtr7g100800.1
Mimulus guttatusmgv1a004664mmgv1a008341mmgv1a011740mmgv1a020319mmgv1a007326m
mgv1a007301mmgv1a010149mmgv1a009864m
Oryza sativaLOC_Os06g47340.1LOC_Os04g55670.1LOC_Os10g13810.1LOC_Os03g17850.1LOC_Os01g48440.1
LOC_Os01g48440.3LOC_Os01g48440.2LOC_Os05g48600.2LOC_Os05g48600.1LOC_Os01g06450.1
LOC_Os04g01280.1LOC_Os05g03174.2LOC_Os05g03174.1LOC_Os07g49370.1
Panicum virgatumPavirv00070690mPavirv00002442mPavirv00049605mPavirv00049604mPavirv00066013m
Pavirv00015553mPavirv00048742mPavirv00020159mPavirv00023302mPavirv00014028m
Pavirv00068635mPavirv00020160mPavirv00041023mPavirv00041022mPavirv00069320m
Pavirv00069319mPavirv00064679mPavirv00025005mPavirv00063696mPavirv00054446m
Pavirv00038884mPavirv00043409mPavirv00036401m
Physcomitrella patensPp1s248_13V6.1Pp1s78_128V6.1Pp1s19_221V6.1Pp1s1_540V6.1Pp1s52_108V6.1
Phaseolus vulgarisPhvul.002G016000.1Phvul.009G107900.2Phvul.009G107900.1Phvul.001G175200.1Phvul.007G164400.2
Phvul.009G146400.1Phvul.007G164400.1
Picea abiesMA_10433413g0010MA_9135945g0010MA_10426088g0010MA_42440g0010
Populus trichocarpaPotri.007G047500.2Potri.007G047500.1Potri.005G141500.1Potri.002G107300.3Potri.002G107300.2
Potri.002G107300.1Potri.006G240200.1Potri.006G240200.2Potri.006G131000.2Potri.006G131000.1
Potri.016G086400.1Potri.018G039900.1
Prunus persicappa004411mppa005926mppa006476mppa007640m
Ricinus communis29794.m00343730170.m01362129805.m001478
Setaria italicaSi006224mSi010088mSi002282mSi036401mSi001449m
Si022019mSi010329mSi010328mSi005128mSi030381m
Si022408m
Selaginella moellendorffii1208278265416278
Sorghum bicolorSb10g027970.1Sb06g030810.1Sb03g011010.1Sb09g028220.1Sb03g030990.1
Sb06g000430.1Sb01g038640.1Sb03g005410.1Sb09g002200.1Sb02g044020.1
Thellungiella halophilaThhalv10024924mThhalv10004084mThhalv10007547mThhalv10016877m
Vitis viniferaGSVIVT01022064001GSVIVT01035647001GSVIVT01025636001GSVIVT01009245001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)