CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra005269
FamilyGH13
Protein PropertiesLength: 846 Molecular Weight: 96022 Isoelectric Point: 4.8752
ChromosomeChromosome/Scaffold: 05 Start: 4424873 End: 4430184
Descriptionstarch branching enzyme 2.1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133436642e-29
  LPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLVVLMDIVHSHASKNTLDGLNMFDGTDGQYFHSGERGYHWMWD
  SRLFNYGSWEVLRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVEFTGNYNEYFGYSTDVDAVVYLMLVNDMIHGLYPEAIVVGEDVSGMPAFCIP
  VEDGGVGFDYRLHMAVADKWIELLKKRDEDWQVGDIVFTLTNRRWGEKCVVYAESHDQALVGDKTIAFWLMDKDMYDFMAVDKQATPRVDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 846     Download
MVYTISGVRF PHLASIKNSS LPSFNDDRRT NAVTFSLRKD TRSSSGKIFA RKPSYDSESS    60
SSIATTASEN LGSHQSDSSS AETQETLSEV TQVHDDVDAQ KAETERQEQT STLSTSGGQS    120
YNENIASMPD SLDQEVVQRK IPPPGDGKKI YDIDPMLKSY DGHLDYRYGQ YIKLREEIDK    180
NEGGLEAFSR GYEIFGFTRS ATGITYREWA PGAKAASLIG DFNNWNSKAD VMTRNEYGVW    240
EIFLPNDADG SPAIPHGSRV KIRMDTTSGI KDSIPAWIKY SVQAPGEIPY DGVYYDPAEE    300
DKYVFKHPRP RKPTSLRIYE SHVGMSSTEP MINTYANFRD DVLPRIKKLG YNAVQIMAIQ    360
EHSYYASFGY HVTNFFAPSS RFGTPDDLKS LIDKAHELGL VVLMDIVHSH ASKNTLDGLN    420
MFDGTDGQYF HSGERGYHWM WDSRLFNYGS WEVLRYLLSN ARWWLEEYKF DGFRFDGVTS    480
MMYTHHGLQV EFTGNYNEYF GYSTDVDAVV YLMLVNDMIH GLYPEAIVVG EDVSGMPAFC    540
IPVEDGGVGF DYRLHMAVAD KWIELLKKRD EDWQVGDIVF TLTNRRWGEK CVVYAESHDQ    600
ALVGDKTIAF WLMDKDMYDF MAVDKQATPR VDRGIALHKM IRLITMGLGG EGYLNFMGNE    660
FGHPEWIDFP RTDQHLPDGR VIPGNNGSYD KCRRRFDLGD AEYLRYHGLQ EFDRAMQHLE    720
EKYGFMTSEH QYISRKDEGD RVIVFEKGNL VFVFNFHWTN SYSDYRIGCS VPGKYKIVLD    780
SDDSSFGGFN RLDDSAEFFT SDGKYDDRPC SLMVYAPCRT AVVYAAVDGD EDSSLVPISL    840
VPDDV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-816724484+
PLN03244PLN032447.0e-136252824581+
PLN02447PLN024470140845711+
cd11321AmyAc_bac_euk_BE0299714417+
PLN02960PLN029600252824577+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB03099.1088454854starch branching enzyme class II [Arabidopsis thaliana]
GenBankABO31359.1018351847starch branching enzyme II-2 [Malus x domestica]
GenBankACA35286.1018321874starch branching enzyme I [Cucumis sativus]
EMBLCAA56319.1018401855starch branching enzyme I [Pisum sativum]
RefSeqNP_181180.1018451858SBE2.1 (starch branching enzyme 2.1); 1,4-alpha-glucan branching enzyme [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A01468329698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B01468329698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A01468329698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A015083213698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D020179024579A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366921448350
HO7776386362008350
HO4581233954338270
HO4581232961444320
HO777638471531990.00000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)