| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra006217 |
| Family | GH1 |
| Protein Properties | Length: 131 Molecular Weight: 14705.7 Isoelectric Point: 4.5099 |
| Chromosome | Chromosome/Scaffold: 03 Start: 2562095 End: 2563180 |
| Description | beta glucosidase 8 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 4 | 99 | 2.2e-25 |
| KQRGSVGLSIYAYGLVPYTESKEDEIATQRAKDFFYGWLLKPVVFGDYPDEMKRILGTRLPVFSEEETELVKGSSDFLGIIHYTTVYIANITPAPS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 131 Download |
| MQSKQRGSVG LSIYAYGLVP YTESKEDEIA TQRAKDFFYG WLLKPVVFGD YPDEMKRILG 60 TRLPVFSEEE TELVKGSSDF LGIIHYTTVY IANITPAPSV LPSKQEFFTD MGVDTIFIGN 120 SYPQWFGTQP * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 2.0e-11 | 19 | 112 | 96 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 4.0e-22 | 5 | 103 | 102 | + Glycosyl hydrolase family 1. | ||
| PLN02998 | PLN02998 | 2.0e-30 | 7 | 121 | 115 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 1.0e-45 | 2 | 114 | 113 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 1.0e-61 | 2 | 121 | 121 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAB43970.1 | 0 | 5 | 113 | 247 | 356 | putative beta-glucosidase [Arabidopsis thaliana] |
| EMBL | CAB43971.1 | 0 | 2 | 121 | 244 | 363 | putative beta-glucosidase [Arabidopsis thaliana] |
| RefSeq | NP_191834.3 | 0 | 2 | 121 | 235 | 355 | BGLU8 (BETA GLUCOSIDASE 8); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_194511.3 | 0 | 5 | 121 | 247 | 364 | BGLU9 (BETA GLUCOSIDASE 9); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_567787.1 | 0 | 2 | 121 | 247 | 366 | BGLU10 (BETA GLUCOSIDASE 10); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 3e-23 | 2 | 97 | 257 | 352 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3ptq_A | 3e-23 | 2 | 97 | 257 | 352 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3ptm_B | 3e-23 | 2 | 97 | 257 | 352 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3ptm_A | 3e-23 | 2 | 97 | 257 | 352 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3ptk_B | 3e-23 | 2 | 97 | 257 | 352 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DN961962 | 120 | 2 | 121 | 0 |
| DN964314 | 120 | 2 | 121 | 0 |
| FD973129 | 125 | 2 | 126 | 0 |
| FD972774 | 125 | 2 | 126 | 0 |
| EX770268 | 121 | 6 | 125 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Aquilegia coerulea | Aquca_003_00737.1 | ||||
| Brassica rapa | Bra020858 | ||||
| Malus domestica | MDP0000310215 | ||||
| Medicago truncatula | Medtr8g038650.1 | ||||
| Prunus persica | ppb019447m | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |