CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra006271
FamilyGT1
Protein PropertiesLength: 335 Molecular Weight: 37752.9 Isoelectric Point: 4.5919
ChromosomeChromosome/Scaffold: 03 Start: 2771993 End: 2773630
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11042986.3e-34
  IGPLCLVNPDKPESDKPSWIHWLDRKQEEKCPVLYLAFGTQTEISKEQLKEIALGLEDSKVNFLWVTRVDVEELTGELGFEKRVKDHGIIVRDWVDQWEI
  LSHESVKGFLSHCGWNSVQESICTGVPLLAWPMMAEQPLNAKLVVEELKVGVRIETVDGSVEGLVTREELSRKVKELIDGDTGKTVKEYAEMAKE
Full Sequence
Protein Sequence     Length: 335     Download
MNNYASALFS SVYVHQLFTK PEIIKSETEP VTVPDFPWIS VKKCEFSPIF THPDRSGPEF    60
ELFVDQIVST GKSRGVIVNS FYELESAFVD FRLRDSDGPK PWCIGPLCLV NPDKPESDKP    120
SWIHWLDRKQ EEKCPVLYLA FGTQTEISKE QLKEIALGLE DSKVNFLWVT RVDVEELTGE    180
LGFEKRVKDH GIIVRDWVDQ WEILSHESVK GFLSHCGWNS VQESICTGVP LLAWPMMAEQ    240
PLNAKLVVEE LKVGVRIETV DGSVEGLVTR EELSRKVKEL IDGDTGKTVK EYAEMAKEAL    300
AQGTGSSWKN LNSLLEELCV SRETNDVNKL SSDN*                               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021673.0e-4973318260+
PLN02534PLN025345.0e-517318342+
PLN02863PLN028631.0e-5434318304+
PLN02448PLN024485.0e-606322342+
PLN03007PLN030072.0e-6013318326+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM62706.101329148478putative glucosyltransferase [Arabidopsis thaliana]
EMBLCAC01885.101334154485glucosyltransferase-like protein [Arabidopsis thaliana]
RefSeqNP_179281.301329148478UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana]
RefSeqNP_196990.201334154491transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002517353.101316144460UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A2.94273e-4428312166461A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2vch_A2.94273e-4428312166461A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2vce_A2.94273e-4428312166461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A4.99997e-4160322213481A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B2e-3673322212465A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
curcumin glucoside biosynthesisRXN-7062EC-2.4.1UDP-glucose:curcumin glucosyltransferase
curcumin glucoside biosynthesisRXN-7063EC-2.4.1UDP-glucose:curcumin monoglucoside glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV11363923512350
EV150366252532980
EH4269152301003250
EV1502002301073320
EV113639202362550.36
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1AT1G10400.1
Brachypodium distachyonBradi2g36325.1Bradi2g36297.1Bradi4g28210.1Bradi1g43760.1Bradi1g37120.1
Bradi2g08147.1
Brassica rapaBra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Gossypium raimondiiGorai.001G265200.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1Potri.005G036100.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)