| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra010190 |
| Family | GT1 |
| Protein Properties | Length: 127 Molecular Weight: 13810.8 Isoelectric Point: 5.6523 |
| Chromosome | Chromosome/Scaffold: 06 Start: 20745166 End: 20745546 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 6 | 122 | 5.2e-22 |
| WVPQVKILSHSSVGGFLTHCGWNSLVEGLGFGRVPILFPVLNEQGLNTRLLEGKGLGVEIPRDEEKGSFDSDSVAHSVRLAMVDDAGESIRAKTKLMMGL FGNMDENSRYVDELIGY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 127 Download |
| MVNVGWVPQV KILSHSSVGG FLTHCGWNSL VEGLGFGRVP ILFPVLNEQG LNTRLLEGKG 60 LGVEIPRDEE KGSFDSDSVA HSVRLAMVDD AGESIRAKTK LMMGLFGNMD ENSRYVDELI 120 GYMRSK* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN00164 | PLN00164 | 6.0e-19 | 6 | 100 | 98 | + glucosyltransferase; Provisional | ||
| PLN02167 | PLN02167 | 4.0e-20 | 5 | 121 | 130 | + UDP-glycosyltransferase family protein | ||
| PLN02992 | PLN02992 | 3.0e-20 | 6 | 100 | 96 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02534 | PLN02534 | 3.0e-21 | 5 | 100 | 106 | + UDP-glycosyltransferase | ||
| PLN02670 | PLN02670 | 2.0e-77 | 1 | 126 | 126 | + transferase, transferring glycosyl groups | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_199780.1 | 0 | 1 | 126 | 329 | 454 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002297733.1 | 1e-35 | 1 | 125 | 336 | 460 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002303861.1 | 8.40779e-45 | 1 | 123 | 342 | 464 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002318358.1 | 2e-34 | 1 | 125 | 339 | 463 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002527371.1 | 2.99878e-43 | 1 | 123 | 340 | 458 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2acw_B | 0.000000000000002 | 5 | 108 | 338 | 464 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 0.000000000000002 | 5 | 108 | 338 | 464 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acv_B | 0.000000000000002 | 5 | 107 | 338 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acv_A | 0.000000000000002 | 5 | 107 | 338 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 3hbj_A | 0.000000000000006 | 4 | 112 | 332 | 438 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DK564829 | 127 | 1 | 127 | 0 |
| DK548948 | 127 | 1 | 127 | 0 |
| DK560840 | 127 | 1 | 127 | 0 |
| EY894771 | 126 | 1 | 126 | 0 |
| DK565942 | 126 | 1 | 126 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
