Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra010190 |
Family | GT1 |
Protein Properties | Length: 127 Molecular Weight: 13810.8 Isoelectric Point: 5.6523 |
Chromosome | Chromosome/Scaffold: 06 Start: 20745166 End: 20745546 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 6 | 122 | 5.2e-22 |
WVPQVKILSHSSVGGFLTHCGWNSLVEGLGFGRVPILFPVLNEQGLNTRLLEGKGLGVEIPRDEEKGSFDSDSVAHSVRLAMVDDAGESIRAKTKLMMGL FGNMDENSRYVDELIGY |
Full Sequence |
---|
Protein Sequence Length: 127 Download |
MVNVGWVPQV KILSHSSVGG FLTHCGWNSL VEGLGFGRVP ILFPVLNEQG LNTRLLEGKG 60 LGVEIPRDEE KGSFDSDSVA HSVRLAMVDD AGESIRAKTK LMMGLFGNMD ENSRYVDELI 120 GYMRSK* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN00164 | PLN00164 | 6.0e-19 | 6 | 100 | 98 | + glucosyltransferase; Provisional | ||
PLN02167 | PLN02167 | 4.0e-20 | 5 | 121 | 130 | + UDP-glycosyltransferase family protein | ||
PLN02992 | PLN02992 | 3.0e-20 | 6 | 100 | 96 | + coniferyl-alcohol glucosyltransferase | ||
PLN02534 | PLN02534 | 3.0e-21 | 5 | 100 | 106 | + UDP-glycosyltransferase | ||
PLN02670 | PLN02670 | 2.0e-77 | 1 | 126 | 126 | + transferase, transferring glycosyl groups |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_199780.1 | 0 | 1 | 126 | 329 | 454 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
RefSeq | XP_002297733.1 | 1e-35 | 1 | 125 | 336 | 460 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002303861.1 | 8.40779e-45 | 1 | 123 | 342 | 464 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002318358.1 | 2e-34 | 1 | 125 | 339 | 463 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002527371.1 | 2.99878e-43 | 1 | 123 | 340 | 458 | UDP-glucosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2acw_B | 0.000000000000002 | 5 | 108 | 338 | 464 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acw_A | 0.000000000000002 | 5 | 108 | 338 | 464 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acv_B | 0.000000000000002 | 5 | 107 | 338 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2acv_A | 0.000000000000002 | 5 | 107 | 338 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 3hbj_A | 0.000000000000006 | 4 | 112 | 332 | 438 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DK564829 | 127 | 1 | 127 | 0 |
DK548948 | 127 | 1 | 127 | 0 |
DK560840 | 127 | 1 | 127 | 0 |
EY894771 | 126 | 1 | 126 | 0 |
DK565942 | 126 | 1 | 126 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|