CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra012542
FamilyGT4
Protein PropertiesLength: 481 Molecular Weight: 54157.5 Isoelectric Point: 9.8385
ChromosomeChromosome/Scaffold: 03 Start: 23690466 End: 23691908
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42974352.9e-25
  SAIVLGVAGRLVKDKGHPLLFEAFSKLIETHSNVYLVVAGTGPWEQRYKKLGDKVTVLGSLSANELKGFYNGIDIFVNPTLRPQGLDLTLMEAMLSGKPV
  MASRYPSIKGSVLVNDEFGFMFAPNVEALTAAMEVAVAE
Full Sequence
Protein Sequence     Length: 481     Download
MPSKTKHKKP RLCTFLFFTV PFSILSLFLL HTSSCSSSTA AFSSSYTYQP PWSGDLRTAQ    60
FPWNRLAFSL TNPPPKTLKL AVFSRKWPDG PNPGGMERHA FTLYTALARR GHRVHVFTSP    120
LHPSLETNKI INLKIHSHGG SEPGKWQYRK AWELYQEENQ KQPFDVVHSE SVALPYWKAR    180
EVPNLAVTWH GIALESLHSS LYQDLIRKPG EPRLQSFNAS LYSAVLPKIL DEIRFFHNYA    240
HHVAISDSCG EMLRDVYQIP EKRVHVILNG VDEKGFASDK KLRSLFRSKL GLQERSSAIV    300
LGVAGRLVKD KGHPLLFEAF SKLIETHSNV YLVVAGTGPW EQRYKKLGDK VTVLGSLSAN    360
ELKGFYNGID IFVNPTLRPQ GLDLTLMEAM LSGKPVMASR YPSIKGSVLV NDEFGFMFAP    420
NVEALTAAME VAVAEGTERL AERGRKCKEY AAEMFTASKM TLAYERLFLC IKDQRFCIYP    480
*                                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03811GT1_WabH_like6.0e-4089457382+
TIGR00032argG2.0e-4191467397+
cd03798GT1_wlbH_like2.0e-4491468402+
cd03807GT1_WbnK_like2.0e-4492468396+
cd03801GT1_YqgM_like4.0e-6779468404+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65716.1014801493unknown [Arabidopsis thaliana]
EMBLCAA16923.2014621475putative protein [Arabidopsis thaliana]
RefSeqNP_567589.10148024516glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002303479.10147913488predicted protein [Populus trichocarpa]
RefSeqXP_002519899.101248019486glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3okp_A0.0000006269398170308A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB3okc_A0.0000006269398170308A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form)
PDB3oka_B0.0000006269398170308A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3oka_A0.0000006269398170308A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB2gek_A0.0000099342934343A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG5599982302444730
FY44075428912760
DK5196382282544810
AM7324152861594440
BX8362652301433720
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00071.1Aquca_004_00554.1
Arabidopsis lyrata316266919149492915
Arabidopsis thalianaAT1G73160.1AT5G59070.1AT4G19460.1
Brachypodium distachyonBradi2g45370.1
Brassica rapaBra003857Bra013399Bra020331
Carica papayaevm.model.supercontig_305.3
Capsella rubellaCarubv10004612mCarubv10021524m
Citrus clementinaCiclev10008126mCiclev10003490m
Citrus sinensisorange1.1g039338morange1.1g044542m
Cucumis sativusCucsa.268510.1
Eucalyptus grandisEucgr.E01172.1Eucgr.F03250.1
Fragaria vescamrna27708.1-v1.0-hybridmrna27178.1-v1.0-hybrid
Glycine maxGlyma09g34990.1Glyma01g35440.1Glyma16g17250.1Glyma16g08210.1
Gossypium raimondiiGorai.009G372800.1Gorai.008G217900.1
Linum usitatissimumLus10032187Lus10014499Lus10033297Lus10034760
Malus domesticaMDP0000252217MDP0000510770MDP0000280727MDP0000690085
Manihot esculentacassava4.1_023608mcassava4.1_022788m
Medicago truncatulaMedtr5g026360.1Medtr8g071900.1
Mimulus guttatusmgv1a005617mmgv1a027119m
Oryza sativaLOC_Os01g46430.1
Panicum virgatumPavirv00039421mPavirv00050283m
Physcomitrella patensPp1s115_97V6.1Pp1s115_97V6.2Pp1s231_59V6.1
Phaseolus vulgarisPhvul.002G124600.1Phvul.003G277200.1
Picea abiesMA_159118g0690MA_58772g0010
Populus trichocarpaPotri.011G097000.1Potri.003G105500.1Potri.001G128300.1
Prunus persicappa004871mppa024212m
Ricinus communis30150.m00047029827.m002616
Setaria italicaSi001150m
Selaginella moellendorffii79637
Sorghum bicolorSb03g029770.1
Thellungiella halophilaThhalv10013459mThhalv10027268mThhalv10019571m
Vitis viniferaGSVIVT01036920001GSVIVT01036921001GSVIVT01036924001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny