| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra012649 |
| Family | AA2 |
| Protein Properties | Length: 156 Molecular Weight: 17436.9 Isoelectric Point: 8.0873 |
| Chromosome | Chromosome/Scaffold: 03 Start: 22933529 End: 22933996 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 3 | 135 | 9.2e-22 |
| SIFKKNGFSLKEMVALSGGHTVGFAHCIEFSSRLFGPRADPELDSRYADRLKDLCKDHTVNKSMAAFLDPITPGKFDNMYFKNLKRGLGLLASDHALFKD NGTRPFVDLYADNQTAFFDDFARAMEKLGMVGV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 156 Download |
| MMSIFKKNGF SLKEMVALSG GHTVGFAHCI EFSSRLFGPR ADPELDSRYA DRLKDLCKDH 60 TVNKSMAAFL DPITPGKFDN MYFKNLKRGL GLLASDHALF KDNGTRPFVD LYADNQTAFF 120 DDFARAMEKL GMVGVKGDND GEVRRKCDHF NKLDV* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 9.0e-16 | 5 | 131 | 145 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| PLN02608 | PLN02608 | 2.0e-16 | 4 | 136 | 139 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 8.0e-21 | 4 | 138 | 145 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| PLN03030 | PLN03030 | 3.0e-24 | 5 | 151 | 157 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 8.0e-69 | 1 | 150 | 154 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM65654.1 | 0 | 4 | 155 | 183 | 334 | peroxidase [Arabidopsis thaliana] |
| GenBank | ABD65151.1 | 0 | 1 | 155 | 175 | 329 | peroxidase, putative [Brassica oleracea] |
| DDBJ | BAB10239.1 | 0 | 4 | 155 | 180 | 331 | peroxidase [Arabidopsis thaliana] |
| RefSeq | NP_193504.1 | 0 | 1 | 155 | 173 | 326 | peroxidase, putative [Arabidopsis thaliana] |
| RefSeq | NP_568674.1 | 0 | 4 | 155 | 183 | 334 | peroxidase, putative [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hdl_A | 3e-28 | 1 | 152 | 148 | 304 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1bgp_A | 1e-27 | 14 | 151 | 171 | 305 | A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 |
| PDB | 1sch_B | 1e-25 | 1 | 151 | 148 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 1e-25 | 1 | 151 | 148 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1qo4_A | 3e-24 | 5 | 151 | 153 | 304 | A Chain A, Peanut Peroxidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DY012068 | 156 | 1 | 156 | 0 |
| EX064626 | 156 | 1 | 156 | 0 |
| GR457778 | 153 | 4 | 156 | 0 |
| DK550089 | 153 | 4 | 156 | 0 |
| EX067970 | 153 | 4 | 156 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
