| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra013991 |
| Family | AA6 |
| Protein Properties | Length: 63 Molecular Weight: 6539.53 Isoelectric Point: 4.044 |
| Chromosome | Chromosome/Scaffold: 08 Start: 4854433 End: 4856264 |
| Description | Quinone reductase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA6 | 2 | 62 | 1.8e-22 |
| QVPGTLQEDLLCKMSAPPNSDAPLITSNDLAEADAFVFGFPTRFSMMAAQFKAFLGATGGL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 63 Download |
| MQVPGTLQED LLCKMSAPPN SDAPLITSND LAEADAFVFG FPTRFSMMAA QFKAFLGATG 60 GL* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam03358 | FMN_red | 4.0e-5 | 31 | 56 | 26 | + NADPH-dependent FMN reductase. | ||
| COG0655 | WrbA | 1.0e-7 | 31 | 56 | 26 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
| TIGR01755 | flav_wrbA | 6.0e-15 | 2 | 62 | 61 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
| PRK03767 | PRK03767 | 2.0e-17 | 2 | 62 | 61 | + NAD(P)H:quinone oxidoreductase; Provisional | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACJ86051.1 | 1e-25 | 2 | 62 | 39 | 99 | unknown [Medicago truncatula] |
| GenBank | ACU13760.1 | 3e-25 | 1 | 62 | 34 | 95 | unknown [Glycine max] |
| EMBL | CAA19721.1 | 4e-27 | 1 | 62 | 44 | 105 | putative protein [Arabidopsis thaliana] |
| RefSeq | NP_194457.2 | 2e-27 | 1 | 62 | 38 | 99 | quinone reductase family protein [Arabidopsis thaliana] |
| RefSeq | NP_200261.1 | 3e-25 | 1 | 62 | 38 | 99 | FQR1 (FLAVODOXIN-LIKE QUINONE REDUCTASE 1); FMN binding / oxidoreductase, acting on NADH or NADPH, quinone or similar compound as acceptor [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4dy4_C | 0.00000007 | 2 | 62 | 37 | 96 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 4dy4_A | 0.00000007 | 2 | 62 | 37 | 96 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6m_B | 0.00000008 | 2 | 62 | 38 | 97 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6m_A | 0.00000008 | 2 | 62 | 38 | 97 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6k_B | 0.00000008 | 2 | 62 | 38 | 97 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| AV553406 | 62 | 1 | 62 | 2e-27 |
| AV544869 | 62 | 1 | 62 | 1e-26 |
| EW721901 | 62 | 1 | 62 | 1e-26 |
| CX518824 | 62 | 1 | 62 | 3e-26 |
| AJ504334 | 62 | 1 | 62 | 3e-26 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
