Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra015354 |
Family | AA6 |
Protein Properties | Length: 128 Molecular Weight: 13684.7 Isoelectric Point: 7.5117 |
Chromosome | Chromosome/Scaffold: 10 Start: 2316184 End: 2316877 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 5 | 62 | 1.6e-24 |
PKSESPIFTPDELTEADGFVFGFPTRYGMMAAQFKVFLDTTGGLRRTQSLAGKPAGSS |
Full Sequence |
---|
Protein Sequence Length: 128 Download |
MSTPPKSESP IFTPDELTEA DGFVFGFPTR YGMMAAQFKV FLDTTGGLRR TQSLAGKPAG 60 SSTAVALKVV AKKPLHTVVN DISSPLKDQS AHVYIICDGG NIEGFATKMT EPQPKYSTTE 120 KQVLDML* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 2.0e-8 | 15 | 60 | 46 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 3.0e-12 | 15 | 66 | 53 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 1.0e-13 | 8 | 66 | 59 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 3.0e-16 | 8 | 65 | 60 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU13985.1 | 3e-26 | 1 | 60 | 52 | 111 | unknown [Glycine max] |
EMBL | CAA19721.1 | 6e-27 | 1 | 60 | 58 | 117 | putative protein [Arabidopsis thaliana] |
RefSeq | NP_194457.2 | 6e-27 | 1 | 60 | 52 | 111 | quinone reductase family protein [Arabidopsis thaliana] |
RefSeq | NP_200261.1 | 6e-28 | 1 | 60 | 52 | 111 | FQR1 (FLAVODOXIN-LIKE QUINONE REDUCTASE 1); FMN binding / oxidoreductase, acting on NADH or NADPH, quinone or similar compound as acceptor [Arabidopsis thaliana] |
RefSeq | XP_002534445.1 | 3e-26 | 1 | 60 | 52 | 111 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0.0000000004 | 9 | 59 | 58 | 108 | PP Chain p, Structural Characterization Of An Lpa1 Second Extracellular Loop Mimetic With A Self-assembling Coiled-coil Folding Constraint |
PDB | 3b6m_A | 0.0000000004 | 9 | 59 | 58 | 108 | PP Chain p, Structural Characterization Of An Lpa1 Second Extracellular Loop Mimetic With A Self-assembling Coiled-coil Folding Constraint |
PDB | 3b6k_B | 0.0000000004 | 9 | 59 | 58 | 108 | PP Chain p, Structural Characterization Of An Lpa1 Second Extracellular Loop Mimetic With A Self-assembling Coiled-coil Folding Constraint |
PDB | 3b6k_A | 0.0000000004 | 9 | 59 | 58 | 108 | PP Chain p, Structural Characterization Of An Lpa1 Second Extracellular Loop Mimetic With A Self-assembling Coiled-coil Folding Constraint |
PDB | 3b6j_B | 0.0000000004 | 9 | 59 | 58 | 108 | PP Chain p, Structural Characterization Of An Lpa1 Second Extracellular Loop Mimetic With A Self-assembling Coiled-coil Folding Constraint |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DK573128 | 76 | 1 | 76 | 4.00001e-40 |
ES897888 | 60 | 1 | 60 | 1e-29 |
FG563405 | 60 | 1 | 60 | 2e-29 |
EE440475 | 60 | 1 | 60 | 2e-29 |
DY015535 | 60 | 1 | 60 | 2e-29 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|