| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra022165 |
| Family | GT1 |
| Protein Properties | Length: 130 Molecular Weight: 14198.4 Isoelectric Point: 6.5219 |
| Chromosome | Chromosome/Scaffold: 05 Start: 19383912 End: 19384301 |
| Description | UDP-glucosyl transferase 88A1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 6 | 103 | 9.3e-29 |
| WAPQVPVLNHKAIGGFVTHCGWNSILEAVCAGVPMVAWPLYAEQRFNRVVIVDEIKIAISMNESDTGFVSSMEVEKRVREVVEEGPVRERTKAMKNAA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 130 Download |
| MVVKSWAPQV PVLNHKAIGG FVTHCGWNSI LEAVCAGVPM VAWPLYAEQR FNRVVIVDEI 60 KIAISMNESD TGFVSSMEVE KRVREVVEEG PVRERTKAMK NAAESALVET GSSRNALTAL 120 LESWSPKQT* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN00164 | PLN00164 | 2.0e-26 | 1 | 122 | 130 | + glucosyltransferase; Provisional | ||
| PLN03007 | PLN03007 | 2.0e-26 | 1 | 125 | 133 | + UDP-glucosyltransferase family protein | ||
| PLN02534 | PLN02534 | 6.0e-27 | 1 | 66 | 66 | + UDP-glycosyltransferase | ||
| PLN02554 | PLN02554 | 8.0e-29 | 3 | 117 | 124 | + UDP-glycosyltransferase family protein | ||
| PLN03004 | PLN03004 | 2.0e-55 | 1 | 116 | 116 | + UDP-glycosyltransferase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM65752.1 | 0 | 1 | 127 | 336 | 462 | putative glucosyltransferase [Arabidopsis thaliana] |
| DDBJ | BAH20428.1 | 0 | 1 | 127 | 56 | 182 | AT3G16520 [Arabidopsis thaliana] |
| RefSeq | NP_566549.1 | 0 | 1 | 116 | 336 | 451 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | NP_566550.1 | 0 | 1 | 127 | 336 | 462 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | NP_850597.1 | 0 | 1 | 110 | 336 | 445 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 1e-29 | 1 | 124 | 341 | 467 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 2vch_A | 1e-29 | 1 | 124 | 341 | 467 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 2vce_A | 1e-29 | 1 | 124 | 341 | 467 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2acv_B | 2e-26 | 6 | 122 | 339 | 459 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acv_A | 2e-26 | 6 | 122 | 339 | 459 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| rose anthocyanin biosynthesis | RXN-8005 | EC-2.4.1 | UDP-D-glucose:cyanidin 5-O-β-D-glucosyltransferase |
| rose anthocyanin biosynthesis | RXN-8006 | EC-2.4.1 | cyanidin 5,3-O-glycosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FY424005 | 130 | 1 | 130 | 0 |
| EY912397 | 130 | 1 | 130 | 0 |
| AV523817 | 127 | 1 | 127 | 0 |
| AV518065 | 127 | 1 | 127 | 0 |
| AV782834 | 127 | 1 | 127 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |