y
Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra026424 |
Family | AA6 |
Protein Properties | Length: 95 Molecular Weight: 10345.2 Isoelectric Point: 9.9804 |
Chromosome | Chromosome/Scaffold: 01 Start: 9384686 End: 9384970 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 5 | 73 | 3.1e-28 |
PKSDAPLITLNDLAKADGFVFCVPTRFGMMAAQFKVFLDKIGGLWRILQLAGKPAGIFYSTGAQRAGQE |
Full Sequence |
---|
Protein Sequence Length: 95 Download |
MSGPPKSDAP LITLNDLAKA DGFVFCVPTR FGMMAAQFKV FLDKIGGLWR ILQLAGKPAG 60 IFYSTGAQRA GQEPHQHLLR FLRFGVFTCV VIDF* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0431 | COG0431 | 0.004 | 17 | 84 | 68 | + Predicted flavoprotein [General function prediction only] | ||
pfam03358 | FMN_red | 9.0e-12 | 17 | 84 | 68 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 1.0e-13 | 17 | 84 | 69 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 6.0e-18 | 9 | 73 | 65 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 4.0e-21 | 8 | 73 | 66 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAO12869.1 | 2e-32 | 1 | 73 | 15 | 87 | putative quinone reductase [Vitis vinifera] |
GenBank | ABN12321.1 | 6e-33 | 1 | 73 | 52 | 124 | benzoquinone reductase [Gossypium hirsutum] |
EMBL | CAA19721.1 | 1e-32 | 1 | 73 | 58 | 130 | putative protein [Arabidopsis thaliana] |
RefSeq | NP_194457.2 | 6e-33 | 1 | 73 | 52 | 124 | quinone reductase family protein [Arabidopsis thaliana] |
RefSeq | XP_002283286.1 | 2e-32 | 1 | 73 | 52 | 124 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0.000000000001 | 2 | 73 | 51 | 121 | A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) |
PDB | 3b6m_A | 0.000000000001 | 2 | 73 | 51 | 121 | A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) |
PDB | 3b6k_B | 0.000000000001 | 2 | 73 | 51 | 121 | A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) |
PDB | 3b6k_A | 0.000000000001 | 2 | 73 | 51 | 121 | A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) |
PDB | 3b6j_B | 0.000000000001 | 2 | 73 | 51 | 121 | A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG571623 | 95 | 1 | 95 | 0 |
AV553406 | 73 | 1 | 73 | 4e-33 |
AI730075 | 73 | 1 | 73 | 5e-33 |
AW737211 | 73 | 1 | 73 | 5e-33 |
GR716593 | 73 | 1 | 73 | 6e-33 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|