| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra028384 |
| Family | GH1 |
| Protein Properties | Length: 129 Molecular Weight: 14791.9 Isoelectric Point: 7.581 |
| Chromosome | Chromosome/Scaffold: 01 Start: 17914218 End: 17914687 |
| Description | beta-glucosidase 45 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 4 | 120 | 5.1e-39 |
| GIKPFVTLNHLDYPQELENRFQSWLSPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFPPSRCSLPYGNCSQGNSEREPFIAAHNTIL AHAKAVHIYRSKYQVTN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 129 Download |
| MYPGIKPFVT LNHLDYPQEL ENRFQSWLSP EMQNDFGYLA DICFKHFGDR VKHWTTLNEP 60 NQQIILTHLK GTFPPSRCSL PYGNCSQGNS EREPFIAAHN TILAHAKAVH IYRSKYQVTN 120 VPVDMICI* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 2.0e-27 | 4 | 114 | 111 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN02814 | PLN02814 | 2.0e-30 | 4 | 117 | 114 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-31 | 4 | 117 | 114 | + Glycosyl hydrolase family 1. | ||
| PLN02849 | PLN02849 | 8.0e-36 | 4 | 117 | 114 | + beta-glucosidase | ||
| PLN02998 | PLN02998 | 6.0e-39 | 4 | 118 | 116 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAC28502.1 | 0 | 4 | 117 | 154 | 267 | Similar to F4I1.26 putative beta-glucosidase gi |
| GenBank | AAU05454.1 | 0 | 4 | 117 | 52 | 165 | At1g61820 [Arabidopsis thaliana] |
| RefSeq | NP_176374.1 | 0 | 4 | 117 | 146 | 259 | BGLU45 (BETA-GLUCOSIDASE 45); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_850968.1 | 0 | 4 | 117 | 143 | 256 | BGLU46 (BETA GLUCOSIDASE 46); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_974067.1 | 0 | 1 | 117 | 1 | 117 | BGLU46 (BETA GLUCOSIDASE 46); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 3e-34 | 4 | 119 | 123 | 239 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gnp_A | 3e-34 | 4 | 119 | 123 | 239 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gno_A | 3e-34 | 4 | 119 | 123 | 239 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_B | 8e-34 | 4 | 118 | 143 | 258 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_A | 8e-34 | 4 | 118 | 143 | 258 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EX069424 | 125 | 4 | 128 | 0 |
| EX072146 | 125 | 4 | 128 | 0 |
| EX068967 | 113 | 4 | 116 | 0 |
| ES902608 | 114 | 4 | 117 | 0 |
| DK481559 | 114 | 4 | 117 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Malus domestica | MDP0000310214 | MDP0000267718 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |