Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra034233 |
Family | CBM43 |
Protein Properties | Length: 111 Molecular Weight: 12174.7 Isoelectric Point: 7.2441 |
Chromosome | Chromosome/Scaffold: 01 Start: 26823278 End: 26823610 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 22 | 101 | 2.3e-32 |
WCVARPSASQAELQRALDWACGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNAYYQTNGNNRIACYFGGTATLTKINPSK |
Full Sequence |
---|
Protein Sequence Length: 111 Download |
MIRPESPIRP EGNTTFLDGT TWCVARPSAS QAELQRALDW ACGIGRVDCS VIEKHGDCYE 60 PDTIWSHASF AFNAYYQTNG NNRIACYFGG TATLTKINPS KFLAPSRVLQ * 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-22 | 21 | 93 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-37 | 21 | 100 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ85566.1 | 9.94922e-44 | 10 | 100 | 45 | 135 | unknown [Medicago truncatula] |
GenBank | ACU17215.1 | 8.00001e-41 | 10 | 100 | 42 | 132 | unknown [Glycine max] |
EMBL | CAB81085.1 | 0 | 2 | 110 | 3 | 111 | putative protein [Arabidopsis thaliana] |
RefSeq | NP_192452.2 | 0 | 2 | 100 | 3 | 101 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002274294.1 | 9.99967e-42 | 10 | 100 | 21 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-17 | 21 | 100 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CF652466 | 100 | 2 | 101 | 0 |
EV255993 | 91 | 10 | 100 | 8.00141e-43 |
FF398339 | 92 | 10 | 101 | 1.99993e-41 |
JG526170 | 90 | 11 | 100 | 3.00004e-41 |
EB715511 | 90 | 11 | 100 | 4.99997e-41 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|