| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra034233 |
| Family | CBM43 |
| Protein Properties | Length: 111 Molecular Weight: 12174.7 Isoelectric Point: 7.2441 |
| Chromosome | Chromosome/Scaffold: 01 Start: 26823278 End: 26823610 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 22 | 101 | 2.3e-32 |
| WCVARPSASQAELQRALDWACGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNAYYQTNGNNRIACYFGGTATLTKINPSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 111 Download |
| MIRPESPIRP EGNTTFLDGT TWCVARPSAS QAELQRALDW ACGIGRVDCS VIEKHGDCYE 60 PDTIWSHASF AFNAYYQTNG NNRIACYFGG TATLTKINPS KFLAPSRVLQ * 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-22 | 21 | 93 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 4.0e-37 | 21 | 100 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACJ85566.1 | 9.94922e-44 | 10 | 100 | 45 | 135 | unknown [Medicago truncatula] |
| GenBank | ACU17215.1 | 8.00001e-41 | 10 | 100 | 42 | 132 | unknown [Glycine max] |
| EMBL | CAB81085.1 | 0 | 2 | 110 | 3 | 111 | putative protein [Arabidopsis thaliana] |
| RefSeq | NP_192452.2 | 0 | 2 | 100 | 3 | 101 | unknown protein [Arabidopsis thaliana] |
| RefSeq | XP_002274294.1 | 9.99967e-42 | 10 | 100 | 21 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-17 | 21 | 100 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CF652466 | 100 | 2 | 101 | 0 |
| EV255993 | 91 | 10 | 100 | 8.00141e-43 |
| FF398339 | 92 | 10 | 101 | 1.99993e-41 |
| JG526170 | 90 | 11 | 100 | 3.00004e-41 |
| EB715511 | 90 | 11 | 100 | 4.99997e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
