| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra034884 |
| Family | PL1 |
| Protein Properties | Length: 156 Molecular Weight: 17157.2 Isoelectric Point: 9.102 |
| Chromosome | Chromosome/Scaffold: 08 Start: 5703059 End: 5703699 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| PL1 | 3 | 75 | 7.4e-25 |
| AILLGHTDSYTKDKMMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTVNSQGNRFLA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 156 Download |
| MQAILLGHTD SYTKDKMMQV TIAYNHFGEG LIQRMPRCRH GYFHVVNNDY THWEMYAIGG 60 SANPTVNSQG NRFLASGNRF AKEVTKRVGA GEGEWNQWNW RSQGDLLLNG AYFTSSGAEA 120 SSSYARSSLA AKSSSLIDML TYSSGVLKCR IGTPC* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3866 | PelB | 2.0e-7 | 3 | 73 | 74 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
| pfam00544 | Pec_lyase_C | 3.0e-31 | 3 | 73 | 71 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. | ||
| smart00656 | Amb_all | 4.0e-32 | 4 | 77 | 74 | + Amb_all domain. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAC42832.1 | 0 | 2 | 155 | 120 | 274 | putative pectate lyase [Arabidopsis thaliana] |
| RefSeq | NP_189110.1 | 0 | 2 | 155 | 286 | 440 | pectate lyase family protein [Arabidopsis thaliana] |
| RefSeq | NP_193057.4 | 0 | 2 | 155 | 247 | 401 | lyase/ pectate lyase [Arabidopsis thaliana] |
| RefSeq | NP_567409.1 | 0 | 2 | 155 | 316 | 470 | pectate lyase family protein [Arabidopsis thaliana] |
| Swiss-Prot | Q9SVQ6 | 0 | 2 | 155 | 264 | 418 | PEL14_ARATH RecName: Full=Putative pectate lyase 14; Flags: Precursor |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1pxz_B | 2e-37 | 2 | 147 | 197 | 345 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1pxz_A | 2e-37 | 2 | 147 | 197 | 345 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 3zsc_A | 0.0001 | 5 | 82 | 166 | 255 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
| PDB | 3krg_A | 0.004 | 5 | 50 | 250 | 295 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 1bn8_A | 0.004 | 5 | 50 | 271 | 316 | A Chain A, Bacillus Subtilis Pectate Lyase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FD954089 | 156 | 2 | 156 | 0 |
| EX767915 | 156 | 2 | 156 | 0 |
| ES980735 | 111 | 2 | 112 | 0 |
| EG449069 | 149 | 2 | 149 | 0 |
| EG449068 | 149 | 2 | 149 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |