| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra035508 |
| Family | GH1 |
| Protein Properties | Length: 136 Molecular Weight: 15826.9 Isoelectric Point: 7.6438 |
| Chromosome | Chromosome/Scaffold: 08 Start: 7963981 End: 7965569 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 14 | 130 | 7.49975e-42 |
| AAMNVYSEGLRNLLKYIKDNYANPEIMIMENGYGEELGATDSIKNGTADHNRKYYLQRHLLSMHEAICIDKVNVTGYFIWSLLDNFEWQDGYKNRFGLYY IDFKNNLTRHEKETAKY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 136 Download |
| MYKTKGIGSQ PFTAAMNVYS EGLRNLLKYI KDNYANPEIM IMENGYGEEL GATDSIKNGT 60 ADHNRKYYLQ RHLLSMHEAI CIDKVNVTGY FIWSLLDNFE WQDGYKNRFG LYYIDFKNNL 120 TRHEKETAKY IIKDS* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 6.0e-16 | 17 | 130 | 116 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| PRK13511 | PRK13511 | 2.0e-22 | 2 | 130 | 139 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 1.0e-24 | 17 | 125 | 110 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 5.0e-31 | 18 | 130 | 114 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 7.0e-34 | 18 | 130 | 114 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB38783.1 | 0 | 6 | 130 | 382 | 506 | beta-glucosidase [Arabidopsis thaliana] |
| DDBJ | BAD94012.1 | 0 | 6 | 130 | 67 | 191 | thioglucosidase 3D precursor [Arabidopsis thaliana] |
| DDBJ | BAH20034.1 | 0 | 6 | 130 | 381 | 505 | AT3G09260 [Arabidopsis thaliana] |
| EMBL | CAA61592.1 | 0 | 6 | 130 | 381 | 505 | thioglucoside glucohydrolase [Arabidopsis thaliana] |
| RefSeq | NP_187537.1 | 0 | 6 | 130 | 381 | 505 | PYK10; beta-glucosidase/ copper ion binding / fucosidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 1e-27 | 5 | 131 | 359 | 484 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_B | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_A | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_B | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_A | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DN778976 | 124 | 7 | 130 | 0 |
| AV543485 | 125 | 6 | 130 | 0 |
| AV537369 | 125 | 6 | 130 | 0 |
| AV543919 | 125 | 6 | 130 | 0 |
| AV546303 | 125 | 6 | 130 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Brassica rapa | Bra029756 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |