Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra035508 |
Family | GH1 |
Protein Properties | Length: 136 Molecular Weight: 15826.9 Isoelectric Point: 7.6438 |
Chromosome | Chromosome/Scaffold: 08 Start: 7963981 End: 7965569 |
Description | Glycosyl hydrolase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 14 | 130 | 7.49975e-42 |
AAMNVYSEGLRNLLKYIKDNYANPEIMIMENGYGEELGATDSIKNGTADHNRKYYLQRHLLSMHEAICIDKVNVTGYFIWSLLDNFEWQDGYKNRFGLYY IDFKNNLTRHEKETAKY |
Full Sequence |
---|
Protein Sequence Length: 136 Download |
MYKTKGIGSQ PFTAAMNVYS EGLRNLLKYI KDNYANPEIM IMENGYGEEL GATDSIKNGT 60 ADHNRKYYLQ RHLLSMHEAI CIDKVNVTGY FIWSLLDNFE WQDGYKNRFG LYYIDFKNNL 120 TRHEKETAKY IIKDS* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
TIGR01233 | lacG | 6.0e-16 | 17 | 130 | 116 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. |
PRK13511 | PRK13511 | 2.0e-22 | 2 | 130 | 139 | + 6-phospho-beta-galactosidase; Provisional |
COG2723 | BglB | 1.0e-24 | 17 | 125 | 110 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] |
TIGR03356 | BGL | 5.0e-31 | 18 | 130 | 114 | + beta-galactosidase. |
pfam00232 | Glyco_hydro_1 | 7.0e-34 | 18 | 130 | 114 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB38783.1 | 0 | 6 | 130 | 382 | 506 | beta-glucosidase [Arabidopsis thaliana] |
DDBJ | BAD94012.1 | 0 | 6 | 130 | 67 | 191 | thioglucosidase 3D precursor [Arabidopsis thaliana] |
DDBJ | BAH20034.1 | 0 | 6 | 130 | 381 | 505 | AT3G09260 [Arabidopsis thaliana] |
EMBL | CAA61592.1 | 0 | 6 | 130 | 381 | 505 | thioglucoside glucohydrolase [Arabidopsis thaliana] |
RefSeq | NP_187537.1 | 0 | 6 | 130 | 381 | 505 | PYK10; beta-glucosidase/ copper ion binding / fucosidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1cbg_A | 1e-27 | 5 | 131 | 359 | 484 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptq_B | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptq_A | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptm_B | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptm_A | 2e-27 | 7 | 133 | 376 | 501 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DN778976 | 124 | 7 | 130 | 0 |
AV543485 | 125 | 6 | 130 | 0 |
AV537369 | 125 | 6 | 130 | 0 |
AV543919 | 125 | 6 | 130 | 0 |
AV546303 | 125 | 6 | 130 | 0 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Brassica rapa | Bra029756 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |