Basic Information | |
---|---|
Species | Brassica rapa |
Cazyme ID | Bra036081 |
Family | CBM43 |
Protein Properties | Length: 120 Molecular Weight: 13141.7 Isoelectric Point: 4.3376 |
Chromosome | Chromosome/Scaffold: 09 Start: 25165140 End: 25165499 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 30 | 114 | 2.4e-33 |
WCVANSDATAEQLQDTIDWCCSDSGGFRDCTPIQPGGVCYEPNTLRDHASFVMNLYYQNEGSTKAQCDFSGTGTEVHDDPSHGPC |
Full Sequence |
---|
Protein Sequence Length: 120 Download |
MVATTMSLSL TVLFFFLLIS TVSRAQRNVW CVANSDATAE QLQDTIDWCC SDSGGFRDCT 60 PIQPGGVCYE PNTLRDHASF VMNLYYQNEG STKAQCDFSG TGTEVHDDPS HGPCIFVHY* 120 |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 1.0e-21 | 30 | 103 | 79 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 1.0e-34 | 30 | 116 | 87 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001031243.1 | 3e-27 | 6 | 116 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_176859.1 | 1e-29 | 6 | 116 | 1 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_201129.1 | 0 | 1 | 119 | 1 | 129 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_201130.1 | 9.80909e-45 | 26 | 119 | 38 | 131 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002283660.1 | 3e-27 | 30 | 117 | 321 | 405 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-23 | 30 | 116 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |