| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra038819 |
| Family | GH16 |
| Protein Properties | Length: 240 Molecular Weight: 27274.6 Isoelectric Point: 9.392 |
| Chromosome | Chromosome/Scaffold: 07 Start: 1299939 End: 1300973 |
| Description | xyloglucan endotransglucosylase/hydrolase 21 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 2 | 132 | 2e-22 |
| QIKLVPGNSAGTVTTFYLKSQGLTWDEIDFEFLGNVSGDPYILHTNVYTQGKGDREQQFYLWFDPTAEFHNYSILWNPSHIVFYVDGKPIREFKNLDAMG VAYPKSQPMRMYGSLWNADDWATRGGLVKTN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 240 Download |
| MQIKLVPGNS AGTVTTFYLK SQGLTWDEID FEFLGNVSGD PYILHTNVYT QGKGDREQQF 60 YLWFDPTAEF HNYSILWNPS HIVFYVDGKP IREFKNLDAM GVAYPKSQPM RMYGSLWNAD 120 DWATRGGLVK TNWSEGPFVA SFMNYNSENA CIWSIDNGTT TNTPCSPSGS SSSSSTSTSE 180 WFSQRGMDSS SRKVLKWVQK KFMVYNYCKD KKRFWQGLPV ECGAKKNNKN KNKNKNIKS* 240 300 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00413 | Glyco_hydrolase_16 | 3.0e-20 | 1 | 127 | 135 | + glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 2.0e-24 | 9 | 140 | 147 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 2.0e-60 | 1 | 134 | 136 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 7.0e-88 | 1 | 222 | 226 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 2.0e-117 | 1 | 222 | 223 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU19964.1 | 0 | 1 | 225 | 76 | 288 | unknown [Glycine max] |
| EMBL | CAD87536.1 | 0 | 1 | 222 | 76 | 287 | putative xyloglucan endotransglycosylase [Cucumis sativus] |
| RefSeq | NP_179470.1 | 0 | 1 | 228 | 75 | 302 | XTH21 (XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 21); hydrolase, acting on glycosyl bonds / xyloglucan endotransglucosylase [Arabidopsis thaliana] |
| RefSeq | XP_002325068.1 | 0 | 1 | 226 | 65 | 275 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002526224.1 | 0 | 1 | 222 | 79 | 289 | Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 227 | 64 | 277 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 1un1_A | 0 | 1 | 227 | 64 | 277 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 1umz_B | 0 | 1 | 227 | 64 | 277 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 227 | 64 | 277 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 9.80909e-45 | 3 | 213 | 67 | 259 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EY943262 | 204 | 22 | 224 | 0 |
| EX105080 | 156 | 1 | 156 | 0 |
| CF836691 | 223 | 1 | 223 | 0 |
| DC899998 | 223 | 1 | 223 | 0 |
| FN697331 | 222 | 1 | 222 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
