| Basic Information | |
|---|---|
| Species | Brassica rapa |
| Cazyme ID | Bra039710 |
| Family | GH9 |
| Protein Properties | Length: 168 Molecular Weight: 18663.9 Isoelectric Point: 4.4483 |
| Chromosome | Chromosome/Scaffold: 08 Start: 6496074 End: 6498747 |
| Description | cellulase 3 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 24 | 147 | 2.5e-24 |
| LTDELMWGAAWLLKATNDLHYKNFIESLGDGDQPDIFNWDNKYAGAYVLLSQQALVNNDNTFDQYKQEAESFICKILPNTPSSSTSYTPGGLMYNYNLPQ SNLQHVMAITFLLTTYAKTIRGGT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 168 Download |
| MGPGSREISS EQQFHVDFCR VRLLTDELMW GAAWLLKATN DLHYKNFIES LGDGDQPDIF 60 NWDNKYAGAY VLLSQQALVN NDNTFDQYKQ EAESFICKIL PNTPSSSTSY TPGGLMYNYN 120 LPQSNLQHVM AITFLLTTYA KTIRGGTAAA MADGERATVY DSVETPV* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03009 | PLN03009 | 8.0e-26 | 18 | 141 | 128 | + cellulase | ||
| pfam00759 | Glyco_hydro_9 | 4.0e-26 | 25 | 150 | 134 | + Glycosyl hydrolase family 9. | ||
| PLN02308 | PLN02308 | 5.0e-27 | 18 | 140 | 127 | + endoglucanase | ||
| PLN02266 | PLN02266 | 2.0e-28 | 18 | 141 | 128 | + endoglucanase | ||
| PLN02175 | PLN02175 | 3.0e-52 | 18 | 144 | 127 | + endoglucanase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM63253.1 | 0 | 18 | 144 | 226 | 350 | putative beta-glucanase [Arabidopsis thaliana] |
| GenBank | ACU19501.1 | 0 | 30 | 141 | 5 | 114 | unknown [Glycine max] |
| RefSeq | NP_001031082.1 | 0 | 18 | 144 | 142 | 266 | CEL5 (CELLULASE 5); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_173701.1 | 0 | 18 | 144 | 226 | 350 | CEL5 (CELLULASE 5); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_177294.1 | 0 | 18 | 144 | 226 | 350 | ATCEL3 (ARABIDOPSIS THALIANA CELLULASE 3); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ksd_A | 0.0000001 | 26 | 117 | 213 | 297 | A Chain A, Crystal Structure Of A Methyltransferase-Like Protein (Spo2022) From Silicibacter Pomeroyi Dss-3 At 1.80 A Resolution |
| PDB | 1ksc_A | 0.0000001 | 26 | 117 | 213 | 297 | A Chain A, Crystal Structure Of A Methyltransferase-Like Protein (Spo2022) From Silicibacter Pomeroyi Dss-3 At 1.80 A Resolution |
| PDB | 1ks8_A | 0.0000001 | 26 | 117 | 213 | 297 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| PDB | 2xfg_A | 0.00002 | 26 | 160 | 234 | 364 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| PDB | 1kfg_B | 0.0001 | 26 | 141 | 212 | 329 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EV571923 | 128 | 18 | 145 | 0 |
| EV566895 | 128 | 18 | 145 | 0 |
| BQ630544 | 124 | 18 | 141 | 1.4013e-45 |
| CK644276 | 120 | 26 | 145 | 5.60519e-45 |
| CK643897 | 120 | 26 | 145 | 9.80909e-45 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Linum usitatissimum | Lus10035475 | ||||
| Picea abies | MA_74652g0010 | MA_97496g0010 | MA_10349916g0010.240.389 | MA_10349916g0010.240.389 | |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |