Basic Information | |
---|---|
Species | Brachypodium distachyon |
Cazyme ID | Bradi1g58357.1 |
Family | CBM43 |
Protein Properties | Length: 127 Molecular Weight: 13529.5 Isoelectric Point: 5.5733 |
Chromosome | Chromosome/Scaffold: 1 Start: 57187660 End: 57188398 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 9 | 92 | 5.1e-35 |
WCVARPGVPQEDLQNALDWACGQGAADCTPLQPGGHCYQPDTLLSHASYAFNIFYQQNGNSDIACNFGGAGTIIKRDPSFGSCK |
Full Sequence |
---|
Protein Sequence Length: 127 Download |
MTFIDGVTWC VARPGVPQED LQNALDWACG QGAADCTPLQ PGGHCYQPDT LLSHASYAFN 60 IFYQQNGNSD IACNFGGAGT IIKRDPSFGS CKFLASETSA ASALILRSMR MMICAAFLTL 120 LQLRVS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-23 | 8 | 80 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 6.0e-43 | 8 | 93 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EAZ02781.1 | 0 | 1 | 125 | 48 | 172 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
GenBank | EAZ38703.1 | 0 | 1 | 125 | 1 | 125 | hypothetical protein OsJ_23103 [Oryza sativa Japonica Group] |
RefSeq | NP_001058896.1 | 0 | 1 | 125 | 1 | 125 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001144702.1 | 0 | 2 | 125 | 51 | 177 | hypothetical protein LOC100277738 [Zea mays] |
RefSeq | XP_002461458.1 | 0 | 1 | 125 | 49 | 176 | hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-22 | 8 | 93 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CJ551134 | 124 | 2 | 125 | 0 |
FF359805 | 124 | 2 | 125 | 0 |
CA092832 | 127 | 1 | 125 | 0 |
CA141830 | 128 | 1 | 125 | 0 |
CA141904 | 127 | 1 | 125 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|