| Basic Information | |
|---|---|
| Species | Brachypodium distachyon |
| Cazyme ID | Bradi3g14430.2 |
| Family | CBM43 |
| Protein Properties | Length: 127 Molecular Weight: 13540.4 Isoelectric Point: 8.4846 |
| Chromosome | Chromosome/Scaffold: 3 Start: 12843577 End: 12844986 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 41 | 124 | 4.6e-27 |
| WCVAKPSTGEDALRANLEFACSESDCSAIQGTGGCSPLYGGVLLSRASVAMNAYYQAKGRNSWNCFFNGTGLIAITDPSLGTCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 127 Download |
| MASSTTVRFI FCALMLLMHR TTYAAARRAP NFQQNQDGKT WCVAKPSTGE DALRANLEFA 60 CSESDCSAIQ GTGGCSPLYG GVLLSRASVA MNAYYQAKGR NSWNCFFNGT GLIAITDPSL 120 GTCKYA* |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| pfam07983 | X8 | 3.0e-17 | 40 | 111 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
| smart00768 | X8 | 3.0e-29 | 40 | 125 | 87 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACG25091.1 | 2.8026e-45 | 3 | 126 | 2 | 122 | glucan endo-1,3-beta-glucosidase precursor [Zea mays] |
| GenBank | EAZ05508.1 | 0 | 20 | 126 | 48 | 155 | hypothetical protein OsI_27724 [Oryza sativa Indica Group] |
| RefSeq | NP_001060942.1 | 0 | 1 | 126 | 1 | 128 | Os08g0135500 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001141170.1 | 2.94273e-44 | 1 | 126 | 1 | 122 | hypothetical protein LOC100273256 [Zea mays] |
| RefSeq | XP_002443816.1 | 4.2039e-45 | 1 | 126 | 1 | 121 | hypothetical protein SORBIDRAFT_07g002710 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 4e-18 | 40 | 125 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
