y
Basic Information | |
---|---|
Species | Brachypodium distachyon |
Cazyme ID | Bradi3g14430.3 |
Family | CBM43 |
Protein Properties | Length: 114 Molecular Weight: 11944.5 Isoelectric Point: 8.0228 |
Chromosome | Chromosome/Scaffold: 3 Start: 12843804 End: 12844986 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 28 | 111 | 3.3e-27 |
WCVAKPSTGEDALRANLEFACSESDCSAIQGTGGCSPLYGGVLLSRASVAMNAYYQAKGRNSWNCFFNGTGLIAITDPSLGTCK |
Full Sequence |
---|
Protein Sequence Length: 114 Download |
MAKLFCDLSA AAARRAPNFQ QNQDGKTWCV AKPSTGEDAL RANLEFACSE SDCSAIQGTG 60 GCSPLYGGVL LSRASVAMNA YYQAKGRNSW NCFFNGTGLI AITDPSLGTC KYA* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-16 | 27 | 98 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-28 | 27 | 112 | 87 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF84562.1 | 2.94273e-44 | 22 | 113 | 32 | 121 | unknown [Zea mays] |
GenBank | ACG25091.1 | 1.96182e-44 | 27 | 113 | 38 | 122 | glucan endo-1,3-beta-glucosidase precursor [Zea mays] |
GenBank | EAZ05508.1 | 0 | 12 | 113 | 53 | 155 | hypothetical protein OsI_27724 [Oryza sativa Indica Group] |
RefSeq | NP_001060942.1 | 1.4013e-45 | 17 | 113 | 31 | 128 | Os08g0135500 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002443816.1 | 1.96182e-44 | 26 | 113 | 34 | 121 | hypothetical protein SORBIDRAFT_07g002710 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-18 | 27 | 112 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GT830847 | 105 | 10 | 114 | 0 |
GT815864 | 105 | 10 | 114 | 0 |
GT815863 | 105 | 10 | 114 | 0 |
BE499247 | 104 | 13 | 114 | 0 |
BE493758 | 114 | 1 | 114 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |