CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g26840.1
FamilyGH18
Protein PropertiesLength: 289 Molecular Weight: 31639.6 Isoelectric Point: 4.5329
ChromosomeChromosome/Scaffold: 3 Start: 27590612 End: 27591715
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18422038.2e-21
  TPVAQQTTPTPTNGVFNAFWDTANLSRASVAAIKAAQPNVSVMVGLGGDSVQDIVKVSFTPSSIDSWVSNAVTSLSAMINEYGLDGVDVDYERFASGVSV
  ETFVECIGRLLTQLKARFPRITTSVAPFEDTEVQRYYQPLWRKYSGVIDFINFQFYGYGDNT
Full Sequence
Protein Sequence     Length: 289     Download
MTNGYLFREY IGAQFTGVKF SDVPVNAGLS FNFILSFAID YTPVAQQTTP TPTNGVFNAF    60
WDTANLSRAS VAAIKAAQPN VSVMVGLGGD SVQDIVKVSF TPSSIDSWVS NAVTSLSAMI    120
NEYGLDGVDV DYERFASGVS VETFVECIGR LLTQLKARFP RITTSVAPFE DTEVQRYYQP    180
LWRKYSGVID FINFQFYGYG DNTDVATYVM FYDLQLSNYP GSGSKLLASF KTGDVTGLLS    240
PEQGISAAME LQRQGKLPGL FIWSADSSKA APYKFDYETR AQQIVANH*                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02871GH18_chitinase_D-like6.0e-668224178+
smart00636Glyco_182.0e-773203145+
pfam00704Glyco_hydro_182.0e-771199135+
cd00598GH18_chitinase-like1.0e-1275267199+
cd06544GH18_narbonin4.0e-1046268264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY78491.1012881288hypothetical protein OsI_33583 [Oryza sativa Indica Group]
RefSeqNP_001064608.1012881288Os10g0416800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131214.1012881286hypothetical protein LOC100192522 [Zea mays]
RefSeqNP_001148230.1012881286chitinase 1 [Zea mays]
RefSeqXP_002449257.1012881286hypothetical protein SORBIDRAFT_05g006880 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B062812271A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A062812271A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A3e-2462864288A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB1h0i_B0.00075419755214A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB1h0i_A0.00075419755214A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV47111328012800
EG37511726212620
EG39576526132630
EG39186225212520
FF35566227292770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_046_00008.1Aquca_014_00353.1Aquca_010_00636.1Aquca_027_00184.1
Brachypodium distachyonBradi3g26850.1Bradi3g26810.1
Carica papayaevm.model.supercontig_139.6
Citrus clementinaCiclev10028881mCiclev10003729m
Citrus sinensisorange1.1g021511morange1.1g046094m
Eucalyptus grandisEucgr.B02439.1Eucgr.J02106.1
Fragaria vescamrna14033.1-v1.0-hybrid.59.211mrna14019.1-v1.0-hybridmrna15882.1-v1.0-hybridmrna14034.1-v1.0-hybridmrna17899.1-v1.0-hybrid
mrna22564.1-v1.0-hybrid
Glycine maxGlyma11g15512.1Glyma09g21615.1Glyma13g40590.1
Gossypium raimondiiGorai.003G135700.1Gorai.003G135800.1Gorai.003G134100.1Gorai.003G129600.1Gorai.011G120000.1
Gorai.003G138400.1
Linum usitatissimumLus10005172
Malus domesticaMDP0000904158MDP0000885802MDP0000644797MDP0000312089
Manihot esculentacassava4.1_024209mcassava4.1_027074m
Medicago truncatulaMedtr6g079630.1Medtr2g096030.1
Mimulus guttatusmgv1a019267mmgv1a024804m
Oryza sativaLOC_Os10g28050.1LOC_Os10g28080.1
Panicum virgatumPavirv00061810mPavirv00014582mPavirv00031712m
Phaseolus vulgarisPhvul.011G069900.1
Picea abiesMA_38396g0010MA_10427109g0010
Populus trichocarpaPotri.012G102400.1Potri.015G100500.1Potri.015G100600.1Potri.001G341700.1
Prunus persicappa023801mppa009038mppa009096m
Ricinus communis30039.m00023530039.m000234
Setaria italicaSi022612mSi026720mSi028172mSi036765mSi036774m
Selaginella moellendorffii41118115493
Sorghum bicolorSb01g021920.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny