CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10007222m
FamilyCE8
Protein PropertiesLength: 758 Molecular Weight: 84393.4 Isoelectric Point: 10.0497
ChromosomeChromosome/Scaffold: 7 Start: 9750923 End: 9753567
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE84477420
  NVVVAKDGSGKCKTIAQALAMVPMNNKRKFVIHIKQGVYKEKVEVSKKMLHVMFVGDGPTKTIITGDIAFLPNRVGTFRTASVAVNGDYFMAKDIGFENT
  AGAARHQAVALRVSADFAVFYNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRKDKRETTGIVIHNSRI
  IGDASYRPVKAKNRAFLGRPWKEYSRTVIMNTEIDDVIDPEGWLKWNETFALNTLFYTEYRNRGRGSGQSRRVRWRGIRRLSSRAVREFSPGNFLR
Full Sequence
Protein Sequence     Length: 758     Download
MKKYVLLGAT ALIIAMVICV EADDGSSPSR KIEEIHRESK LVITRTAVSI ICASTDYKED    60
CTSSLATVRT PDPRTIIRAS FDLAMLSIRS GIDRGLIDLK SKADADVHTR EALNTCRELM    120
DDAIDDLRKT RDRFRGFLFT RLPDFVEDLC VWLSGSITYQ QTCIDGFEGI DSEAAMMMEK    180
VMRKGQHLTS NGLAIASNLD SLLKAFRIPI PFLGSRRGRL GILGSSRDEP SDSSQDPPSD    240
VDSSENSSEP IDSSENRPSD SSQNKTLDSS NNRLTNSSNN RPLESSQTSP QQSTSSQSRP    300
TASSEKLPQN STSSGNQPLT SSEIPSQKLI STGNRPAVSS EKLPQNSTSS GNQPLSSSEI    360
PSQKSTYTGN QPLGPPQNSD SSVTRPFDPL QKLNPPIGKL DSLNDRHLSE EEEFPPWVTL    420
HSRRLLARRI RRRPKKGMRA SKGIRANVVV AKDGSGKCKT IAQALAMVPM NNKRKFVIHI    480
KQGVYKEKVE VSKKMLHVMF VGDGPTKTII TGDIAFLPNR VGTFRTASVA VNGDYFMAKD    540
IGFENTAGAA RHQAVALRVS ADFAVFYNCH MNGYQDTLYV HTHRQFYRDC RISGTIDFVF    600
GDAKAVFQNC VFVIRRPMDN QQCIVTAQGR KDKRETTGIV IHNSRIIGDA SYRPVKAKNR    660
AFLGRPWKEY SRTVIMNTEI DDVIDPEGWL KWNETFALNT LFYTEYRNRG RGSGQSRRVR    720
WRGIRRLSSR AVREFSPGNF LRGNTWIPQT RIPYNAN* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02217PLN022171.0e-252209213+
PLN02990PLN029905.0e-452208213+
PLN02217PLN022175.0e-121399754356+
PLN02990PLN029904.0e-153398757360+
pfam01095Pectinesterase5.0e-177447744299+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_193333.1017571701pectinesterase family protein [Arabidopsis thaliana]
RefSeqNP_199729.12e-364620853217pectinesterase family protein [Arabidopsis thaliana]
RefSeqNP_199729.10398757222569pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002314364.11e-273321745227predicted protein [Populus trichocarpa]
RefSeqXP_002314364.10390756215566predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A04477558316A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A04447541311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B3e-294477485339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A3e-294477485339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B5e-294477485339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR4595362644437060
GR4626762824727530
GR4517082574457010
ES2701962394687060
DT7541572724857560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_019_00179.1Aquca_017_00134.1Aquca_017_00135.1Aquca_020_00598.1Aquca_012_00160.1
Aquca_035_00109.1Aquca_035_00108.1Aquca_029_00052.1
Arabidopsis lyrata477851910790494979478002859154
320434353497486726483877
Arabidopsis thalianaAT3G05610.1AT5G27870.1AT5G49180.1AT3G06830.1AT4G15980.1
AT4G33230.1AT2G26450.1AT2G47030.1AT2G47040.1AT3G62170.1
Brachypodium distachyonBradi5g23550.1Bradi4g30980.1Bradi1g64860.1Bradi5g12300.1Bradi1g16780.1
Bradi1g60380.1
Brassica rapaBra039421Bra036610Bra009938Bra040293Bra040532
Bra029607Bra020658Bra038049Bra001219Bra000541
Bra001157Bra037013Bra004481Bra000438Bra040474
Bra007665Bra014410Bra003491
Carica papayaevm.model.supercontig_50.162evm.model.supercontig_48.111evm.model.supercontig_82.46evm.model.supercontig_146.24evm.model.supercontig_41.94
Capsella rubellaCarubv10015948mCarubv10003818mCarubv10027546mCarubv10015933mCarubv10024513m
Carubv10006885mCarubv10024512mCarubv10025567mCarubv10019418m
Citrus clementinaCiclev10000446mCiclev10000436mCiclev10000435mCiclev10000415mCiclev10007819m
Ciclev10010665m
Citrus sinensisorange1.1g039111morange1.1g035494m
Cucumis sativusCucsa.159100.1Cucsa.181720.1Cucsa.252880.1Cucsa.069220.1Cucsa.374170.1
Cucsa.374150.1Cucsa.374190.1
Fragaria vescamrna22811.1-v1.0-hybridmrna07045.1-v1.0-hybridmrna07046.1-v1.0-hybridmrna07048.1-v1.0-hybridmrna12964.1-v1.0-hybrid
mrna24568.1-v1.0-hybrid
Glycine maxGlyma15g20460.1Glyma09g08910.2Glyma02g01140.1Glyma10g01180.1Glyma0248s00220.1
Glyma07g02790.1Glyma07g02780.1Glyma07g03010.1Glyma07g02750.1Glyma03g39360.1
Glyma01g27260.1Glyma07g37460.1Glyma17g03170.1Glyma19g41970.1Glyma10g29160.1
Glyma20g38160.3Glyma20g38160.2Glyma09g04730.1Glyma09g04720.1Glyma17g04960.1
Glyma13g17550.1Glyma10g27700.1Glyma03g38230.2Glyma02g01130.1Glyma10g27710.1
Glyma19g40840.1Glyma15g16141.1
Gossypium raimondiiGorai.009G039000.1Gorai.007G340800.1Gorai.007G302000.1Gorai.006G260800.1Gorai.006G260900.1
Gorai.006G260600.1Gorai.006G260700.1Gorai.004G238800.1Gorai.008G137200.1Gorai.004G146900.1
Gorai.013G218500.1Gorai.007G098400.1Gorai.005G257300.1
Linum usitatissimumLus10006940Lus10015211Lus10031469Lus10018335Lus10037489
Lus10039927Lus10020909Lus10027656Lus10033466Lus10023775
Lus10003968Lus10002976
Malus domesticaMDP0000545023.286.580MDP0000545023.286.580MDP0000267129MDP0000823143MDP0000785852
MDP0000193371MDP0000136674MDP0000200340MDP0000686191MDP0000389664
MDP0000850802MDP0000304455.261.433MDP0000304455.261.433
Manihot esculentacassava4.1_025863mcassava4.1_030825mcassava4.1_027130mcassava4.1_027642mcassava4.1_033112m
cassava4.1_024664mcassava4.1_029816mcassava4.1_029447mcassava4.1_030418mcassava4.1_032868m
Medicago truncatulaMedtr7g112590.1Medtr1g083510.1Medtr1g083500.1Medtr1g083470.1Medtr1g083490.1
Medtr4g005170.1Medtr4g005180.1Medtr1g086190.1Medtr1g086210.1Medtr4g124550.1
Medtr2g044650.1Medtr7g110440.1Medtr7g110510.1Medtr7g110490.1Medtr7g110560.1
Medtr7g110420.1Medtr8g088610.1Medtr5g083620.1Medtr5g083590.1
Mimulus guttatusmgv1a003232mmgv1a003546mmgv1a000814mmgv1a002232mmgv1a003747m
mgv1a003776mmgv1a004121mmgv1a003434mmgv1a003444mmgv1a003726m
mgv1a003697mmgv1a012115mmgv1a027033m
Oryza sativaLOC_Os04g38560.1LOC_Os09g26360.1LOC_Os04g54850.1LOC_Os03g18860.1LOC_Os08g34910.1
LOC_Os03g28090.1LOC_Os07g49100.1
Panicum virgatumPavirv00011682mPavirv00013701mPavirv00057767mPavirv00019846mPavirv00022990m
Pavirv00056855mPavirv00035617mPavirv00014003mPavirv00066510mPavirv00001150m
Phaseolus vulgarisPhvul.007G210400.1Phvul.003G107300.1Phvul.005G015000.1Phvul.005G104100.1Phvul.006G088200.1
Phvul.009G250600.1Phvul.009G222600.1Phvul.007G198100.1Phvul.003G126700.1Phvul.007G198100.2
Phvul.001G217400.1Phvul.001G217300.1Phvul.007G210300.1Phvul.007G210200.1
Populus trichocarpaPotri.018G051200.1Potri.006G134700.1Potri.T030500.1Potri.005G022900.1Potri.013G013400.1
Potri.001G209000.1Potri.003G021600.1Potri.003G021300.1Potri.001G209200.1
Prunus persicappa023802mppa003528mppa026560mppa025631mppa024011m
ppa003441mppa023319mppa003569mppa020185mppa003369m
Ricinus communis29739.m00367629726.m00408330128.m00885829889.m00339630116.m000390
30116.m000389
Setaria italicaSi009724mSi009788mSi015620mSi032329mSi032614m
Si040154m
Sorghum bicolorSb06g018850.1Sb06g030310.1Sb01g037900.1Sb07g022100.1Sb02g025460.1
Sb01g033140.1Sb02g043780.1
Thellungiella halophilaThhalv10003734mThhalv10020314mThhalv10003919mThhalv10020401mThhalv10024582m
Thhalv10024699mThhalv10001934mThhalv10001369mThhalv10005855m
Vitis viniferaGSVIVT01035108001GSVIVT01031165001GSVIVT01017687001GSVIVT01028264001GSVIVT01028265001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)