CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10007281m
FamilyAA2
Protein PropertiesLength: 194 Molecular Weight: 20457.7 Isoelectric Point: 4.6922
ChromosomeChromosome/Scaffold: 7 Start: 5593624 End: 5594529
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2471813e-38
  PNLPAILLRLHFHDCFVEGCDGSILVDNGAISEKNAFGHEGVRGFEIVEAIKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGLVSNMS
  LAKDMPEISDTIQILKAKFMQKGLNAKELVLLSVS
Full Sequence
Protein Sequence     Length: 194     Download
MSLALSLVTV ILSVSLADLK VGFYSNTCPQ AESIVRRVVS GAALSDPNLP AILLRLHFHD    60
CFVEGCDGSI LVDNGAISEK NAFGHEGVRG FEIVEAIKAE LEAACPGVVS CSDIVALAAR    120
DAISLANGPA YEVPTGRRDG LVSNMSLAKD MPEISDTIQI LKAKFMQKGL NAKELVLLSV    180
SRASVLYEIL VDQ* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like3.0e-1153174136+
pfam00141peroxidase2.0e-5635174141+
PLN03030PLN030304.0e-6120174155+
cd00693secretory_peroxidase5.0e-8919174158+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD37375.101517936200AF145349_1 peroxidase [Glycine max]
GenBankAAL93153.101218316187AF485267_1 class III peroxidase [Gossypium hirsutum]
GenBankACU17962.1031796182unknown [Glycine max]
RefSeqNP_194328.10118353235cationic peroxidase, putative [Arabidopsis thaliana]
Swiss-ProtQ9SZH2011838190PER43_ARATH RecName: Full=Peroxidase 43; Short=Atperox P43; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A7.00649e-45191793167A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB1pa2_A7.00649e-45191793167A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B9.80909e-45191794168A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A9.80909e-45191794168A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1gwo_A2.99878e-43191793168A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK252249158171740
FG557788150171660
FK019269158171740
EV263072158171740
BE660607158171740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00892.1Aquca_007_00386.1Aquca_007_00388.1Aquca_022_00275.1
Arabidopsis lyrata870602919714919715496608494031
329078316625316622351860920775
Arabidopsis thalianaAT2G41480.1AT5G64110.1AT5G39580.1AT5G64120.1AT5G64100.1
AT4G25980.1AT1G77100.1AT5G39580.2
Brachypodium distachyonBradi2g04490.1Bradi4g22660.1Bradi4g40680.1
Brassica rapaBra000228Bra016930Bra024268Bra031934Bra024269
Bra028436Bra024267Bra013938Bra031933Bra015695
Bra008291
Carica papayaevm.model.supercontig_42.86evm.model.supercontig_468.4evm.model.supercontig_468.3evm.model.supercontig_75.24evm.model.supercontig_49.72
evm.model.supercontig_42.87evm.TU.contig_36964.1evm.model.supercontig_845.4
Capsella rubellaCarubv10023605mCarubv10007711mCarubv10026774mCarubv10026761mCarubv10027924m
Carubv10021650m
Citrus clementinaCiclev10008925mCiclev10001751mCiclev10003869m
Citrus sinensisorange1.1g020511morange1.1g045530morange1.1g019638morange1.1g041705m
Cucumis sativusCucsa.217820.1Cucsa.292700.1Cucsa.217830.1Cucsa.345800.1Cucsa.292740.1
Cucsa.292700.2
Eucalyptus grandisEucgr.I02673.1Eucgr.L02460.2Eucgr.L02460.1Eucgr.L02460.4Eucgr.L02460.3
Eucgr.G00658.1Eucgr.F04267.1Eucgr.L01488.1Eucgr.L02460.6Eucgr.L02460.5
Fragaria vescamrna13503.1-v1.0-hybridmrna10707.1-v1.0-hybridmrna31037.1-v1.0-hybridmrna02015.1-v1.0-hybridmrna10709.1-v1.0-hybrid
mrna17058.1-v1.0-hybrid
Glycine maxGlyma08g19170.1Glyma13g23620.2Glyma06g28890.1Glyma15g05810.1Glyma15g05820.1
Glyma08g19180.1Glyma08g19340.1Glyma15g05650.1Glyma1655s00200.1Glyma15g05831.1
Gossypium raimondiiGorai.002G013000.1Gorai.012G141300.1Gorai.005G219200.1Gorai.005G219400.1Gorai.005G219100.1
Gorai.009G017700.2Gorai.009G017700.1Gorai.012G141500.1Gorai.012G141500.2Gorai.002G208800.1
Linum usitatissimumLus10007051Lus10012684Lus10007052Lus10020826Lus10015555
Lus10028631Lus10020421Lus10007050Lus10018929
Malus domesticaMDP0000298078MDP0000198353MDP0000184865MDP0000299137MDP0000515971
MDP0000684133MDP0000136412MDP0000493703MDP0000843352MDP0000527985
MDP0000139136
Manihot esculentacassava4.1_011950mcassava4.1_032385mcassava4.1_024068mcassava4.1_011945mcassava4.1_029449m
Medicago truncatulaMedtr4g114450.1Medtr4g114210.1Medtr2g008710.1Medtr2g008730.1Medtr2g008160.1
Medtr2g008710.2Medtr2g008160.2
Mimulus guttatusmgv1a009839mmgv1a023088mmgv1a019228mmgv1a018852m
Oryza sativaLOC_Os01g07770.1LOC_Os11g10460.1LOC_Os12g08920.1
Panicum virgatumPavirv00006707mPavirv00035647mPavirv00001257mPavirv00018071mPavirv00058650m
Pavirv00013421m
Physcomitrella patensPp1s22_167V6.1Pp1s22_159V6.1
Phaseolus vulgarisPhvul.006G207100.1Phvul.009G197100.1Phvul.003G164600.1Phvul.006G209100.1
Picea abiesMA_93867g0010MA_10426026g0010MA_10429595g0010MA_10434825g0010MA_9805677g0010
Populus trichocarpaPotri.006G069600.1Potri.018G131600.1Potri.016G125000.1
Prunus persicappa008723mppa008667m
Ricinus communis28320.m00113629989.m00043230174.m00915527985.m000888
Setaria italicaSi002216mSi026601mSi010572m
Selaginella moellendorffii10494613291523327112210075799
8986123609714593212686397402
13675973829123452
Sorghum bicolorSb03g004380.1Sb08g005520.1Sb05g009400.1
Thellungiella halophilaThhalv10016924mThhalv10004567mThhalv10004581mThhalv10004557mThhalv10019514m
Thhalv10025604m
Vitis viniferaGSVIVT01015537001GSVIVT01015533001.522.787GSVIVT01015533001.522.787GSVIVT01015533001.49.309GSVIVT01015533001.49.309
GSVIVT01029748001GSVIVT01029771001GSVIVT01029776001GSVIVT01029774001GSVIVT01029775001
GSVIVT01029773001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)