| Basic Information | |
|---|---|
| Species | Capsella rubella |
| Cazyme ID | Carubv10011462m |
| Family | CE8 |
| Protein Properties | Length: 112 Molecular Weight: 12662.6 Isoelectric Point: 7.854 |
| Chromosome | Chromosome/Scaffold: 1 Start: 16360274 End: 16362431 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 3 | 89 | 2.3e-23 |
| DQYVFYRCSIEGYQDTLYAYSNLQFYCYCDLYETVNLIFGNTAAVYQNCNIFARVLLVVPTQLITAKKIFTHRKMTGIFIHIFHVTA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 112 Download |
| MLDQYVFYRC SIEGYQDTLY AYSNLQFYCY CDLYETVNLI FGNTAAVYQN CNIFARVLLV 60 VPTQLITAKK IFTHRKMTGI FIHIFHVTAA TLFCGEFQNT GPGASTLGRV T* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02314 | PLN02314 | 2.0e-25 | 3 | 110 | 154 | + pectinesterase | ||
| PLN03043 | PLN03043 | 5.0e-26 | 3 | 110 | 158 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
| PLN02506 | PLN02506 | 1.0e-26 | 3 | 110 | 149 | + putative pectinesterase/pectinesterase inhibitor | ||
| PLN02468 | PLN02468 | 9.0e-27 | 3 | 110 | 154 | + putative pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 5.0e-32 | 3 | 111 | 159 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN78759.1 | 3e-22 | 3 | 110 | 317 | 473 | hypothetical protein [Vitis vinifera] |
| EMBL | CAN83663.1 | 5e-22 | 3 | 110 | 316 | 472 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_191930.1 | 3e-22 | 3 | 110 | 280 | 434 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | NP_566038.1 | 9e-26 | 3 | 111 | 316 | 473 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002265599.1 | 5e-22 | 3 | 110 | 316 | 472 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 1e-16 | 3 | 111 | 122 | 280 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.0000000000008 | 3 | 110 | 118 | 275 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_B | 0.0000003 | 3 | 56 | 140 | 193 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_A | 0.0000003 | 3 | 56 | 140 | 193 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntp_B | 0.0000003 | 3 | 56 | 140 | 193 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
