y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10012005m
FamilyGT77
Protein PropertiesLength: 326 Molecular Weight: 37424.9 Isoelectric Point: 8.1308
ChromosomeChromosome/Scaffold: 1 Start: 9861419 End: 9862574
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT77952870
  LDHLMVVTADQTAYDRCRFKRLHCYKMETDGLDLEEEKIFMSKGFIEMMWQRTRLLLDVLRRGYHVIFTDTDVMWLRNPLSQLNVSLDMQISVDSTFRGG
  HLINTGFYHVRSNNKTISLFRQWYDMRLNSTGMKEQDVLKNLLDSGYFDQLGLSVGLLNTNEFSGFCQDSSDMGAVTTVHANCCRHISAKVFD
Full Sequence
Protein Sequence     Length: 326     Download
MRNNFSGSLA VAVALLFIGV LYIFNLQNYA NTLRSTEYPV DDLEAALRKA AAGNNKTVII    60
TMVNKAYVED VGRGRTMLDL FLESFWEGQG TRPLLDHLMV VTADQTAYDR CRFKRLHCYK    120
METDGLDLEE EKIFMSKGFI EMMWQRTRLL LDVLRRGYHV IFTDTDVMWL RNPLSQLNVS    180
LDMQISVDST FRGGHLINTG FYHVRSNNKT ISLFRQWYDM RLNSTGMKEQ DVLKNLLDSG    240
YFDQLGLSVG LLNTNEFSGF CQDSSDMGAV TTVHANCCRH ISAKVFDLTR VLRDWKRYKA    300
SHVNSKWSPH VMCGRSWNDT YIPNL*                                         360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans4.0e-6094288207+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF24543.1033135316AC007508_6 F1K23.11 [Arabidopsis thaliana]
RefSeqNP_001154379.10533252278unknown protein [Arabidopsis thaliana]
RefSeqNP_174191.202632540338unknown protein [Arabidopsis thaliana]
RefSeqNP_564315.103432545340unknown protein [Arabidopsis thaliana]
RefSeqNP_973933.1033255329unknown protein [Arabidopsis thaliana]
Transmembrane Domains
StartEnd
524
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EW728163274533230
FY430354283233030
EG465601281263060
EG465621275263000
EG465605266342990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00097.1Aquca_053_00106.1Aquca_002_01394.1Aquca_040_00051.1Aquca_053_00096.1
Arabidopsis thalianaAT5G44820.1AT4G19970.1.489.686AT4G19970.1.489.686AT1G28710.3AT1G28710.2
AT1G28710.1AT1G28700.1AT2G02061.1AT1G14590.1AT4G19970.1.149.346
AT4G19970.1.149.346AT4G15970.1AT1G28695.1AT5G40900.1
Brachypodium distachyonBradi2g59017.1Bradi1g52610.1Bradi2g58994.1Bradi5g19577.1Bradi1g09720.1
Bradi3g51990.1Bradi1g76460.1Bradi1g01750.1Bradi1g01760.1Bradi2g58987.1
Bradi1g49780.1Bradi4g34530.1Bradi4g34540.1Bradi2g59010.1Bradi4g34570.1
Bradi3g41140.1Bradi2g59027.1Bradi4g34590.1Bradi4g34520.1Bradi2g59001.1
Brassica rapaBra025100Bra025101Bra012524Bra014090Bra002916
Bra024835Bra013434Bra027575Bra014901Bra038406
Bra028479Bra021946
Carica papayaevm.model.supercontig_13.215evm.model.supercontig_30.146evm.model.supercontig_2.84evm.model.supercontig_2596.1evm.model.supercontig_1017.2
Capsella rubellaCarubv10026625mCarubv10004249m.489.686Carubv10004249m.489.686Carubv10019169mCarubv10009619m
Carubv10009437mCarubv10004249m.147.344Carubv10004249m.147.344Carubv10027641mCarubv10027757m
Carubv10007406mCarubv10011614mCarubv10006582m
Citrus clementinaCiclev10010447mCiclev10020796mCiclev10006749mCiclev10008749mCiclev10008659m
Ciclev10018179mCiclev10018159m
Citrus sinensisorange1.1g040326morange1.1g017526morange1.1g016761morange1.1g044643morange1.1g018473m
orange1.1g017033morange1.1g016995morange1.1g038629m
Cucumis sativusCucsa.256730.1Cucsa.194020.1Cucsa.377380.1Cucsa.112460.1
Eucalyptus grandisEucgr.A02942.1Eucgr.K00112.1Eucgr.H00616.2Eucgr.H00616.1Eucgr.G02042.1
Eucgr.D01203.1Eucgr.E01659.1
Fragaria vescamrna00598.1-v1.0-hybridmrna21406.1-v1.0-hybridmrna09286.1-v1.0-hybridmrna05326.1-v1.0-hybrid
Glycine maxGlyma16g34240.2Glyma16g34260.2Glyma03g25600.2Glyma03g25590.2Glyma07g13220.2
Glyma07g19600.2Glyma20g24350.1Glyma20g00871.2Glyma20g00871.1Glyma10g42700.2
Glyma16g34271.2Glyma16g34271.1Glyma16g34250.2Glyma09g34480.4Glyma09g34480.3
Glyma09g34480.2Glyma09g34480.1Glyma16g34280.1Glyma09g29670.1Glyma17g21810.2
Glyma16g06180.1
Gossypium raimondiiGorai.004G068600.1Gorai.005G155400.2Gorai.005G155400.1Gorai.004G068700.1Gorai.008G110400.1
Gorai.008G169200.2Gorai.008G169200.1
Linum usitatissimumLus10017981Lus10034422Lus10019139Lus10017982Lus10032455
Lus10031330Lus10031903Lus10031927Lus10041973Lus10041976
Lus10041977Lus10041975
Malus domesticaMDP0000197874MDP0000234123MDP0000298955MDP0000305973.152.349MDP0000305973.152.349
MDP0000305973.476.673MDP0000305973.476.673MDP0000785615MDP0000646858MDP0000309587
MDP0000248652MDP0000225024MDP0000215737
Manihot esculentacassava4.1_021057mcassava4.1_008667mcassava4.1_026163mcassava4.1_009155mcassava4.1_026132m
Medicago truncatulaMedtr1g034810.1Medtr6g081060.1AC202489_10.1Medtr1g044340.1
Mimulus guttatusmgv1a007746mmgv1a013635mmgv1a024088mmgv1a020419mmgv1a011268m
mgv1a007657mmgv1a022000mmgv1a009278m
Oryza sativaLOC_Os03g03730.1LOC_Os07g19444.1LOC_Os04g49590.1LOC_Os03g52160.1LOC_Os01g69140.1
LOC_Os02g46120.2LOC_Os02g46120.1LOC_Os03g63270.1LOC_Os03g63280.1LOC_Os01g69160.1
LOC_Os08g41800.1LOC_Os01g69200.1LOC_Os01g69190.1
Panicum virgatumPavirv00048073mPavirv00036490mPavirv00004969mPavirv00061166mPavirv00001745m
Pavirv00001744mPavirv00029787mPavirv00013532mPavirv00004840mPavirv00048329m
Pavirv00045318mPavirv00060429mPavirv00065844mPavirv00029786mPavirv00008953m
Pavirv00004842mPavirv00060898mPavirv00032687mPavirv00010532mPavirv00040930m
Pavirv00043582mPavirv00029788mPavirv00040931mPavirv00010531mPavirv00015487m
Pavirv00037239mPavirv00053993mPavirv00031613mPavirv00061238mPavirv00055330m
Pavirv00050538mPavirv00041792m
Physcomitrella patensPp1s68_81V6.1Pp1s98_155V6.1Pp1s69_44V6.1.146.245Pp1s69_44V6.1.146.245Pp1s98_155V6.3
Pp1s68_125V6.1Pp1s111_58V6.1Pp1s69_44V6.1.62.138Pp1s69_44V6.1.62.138Pp1s98_155V6.2
Phaseolus vulgarisPhvul.007G020400.1Phvul.010G044600.1Phvul.010G044400.1Phvul.003G008500.1Phvul.004G142200.1
Phvul.004G142100.1Phvul.004G142300.1Phvul.001G094600.2Phvul.001G094600.1
Picea abiesMA_501889g0010MA_132232g0010MA_607856g0010MA_10428482g0010MA_10432108g0010
MA_10434802g0010MA_386090g0010MA_8135787g0010MA_373999g0010MA_184747g0010
MA_898978g0010MA_10433997g0010MA_140045g0010MA_9004089g0010MA_179108g0010
MA_10429744g0010MA_6668110g0010MA_8547205g0010MA_175330g0010MA_955315g0010
MA_37650g0010
Populus trichocarpaPotri.014G051600.1Potri.012G037300.1Potri.015G029200.3Potri.015G029200.2Potri.015G029200.1
Potri.012G114800.1Potri.012G113200.1Potri.012G112600.1Potri.010G099400.2Potri.010G099400.1
Potri.002G139800.1Potri.008G142200.2Potri.008G142200.1Potri.015G110600.1
Prunus persicappa007679mppa022545mppa006741mppa021342mppa017327m
ppa018804mppa020835mppa008443m
Ricinus communis29780.m00136629709.m00118330147.m01436428613.m00013930190.m010943
Setaria italicaSi036243mSi029892mSi040232mSi001490mSi032504m
Si039211mSi017461mSi012694mSi036241mSi035913m
Si002012mSi013954mSi003819mSi003892mSi027875m
Si030349mSi032505mSi004175mSi030341mSi001867m
Sorghum bicolorSb03g044030.1Sb01g048460.1Sb06g026610.1Sb02g009460.2Sb02g009460.1
Sb03g044020.1Sb04g031550.1Sb01g001260.1Sb07g026310.1Sb01g001250.1
Sb02g029220.1Sb02g019390.1Sb03g044060.1Sb03g044050.1Sb03g044040.1
Sb01g009150.1Sb03g044070.1
Thellungiella halophilaThhalv10025579mThhalv10000930mThhalv10000936mThhalv10000933mThhalv10028197m
Thhalv10029163mThhalv10027358mThhalv10011621mThhalv10025388mThhalv10004358m
Thhalv10025491mThhalv10000928mThhalv10026960mThhalv10001209mThhalv10026780m
Thhalv10009446mThhalv10009695mThhalv10026794m
Vitis viniferaGSVIVT01018317001GSVIVT01029389001.419.532GSVIVT01029389001.419.532GSVIVT01018316001GSVIVT01010291001
GSVIVT01024334001GSVIVT01029389001.108.221GSVIVT01029389001.108.221
Zea maysAC211891.4_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)