Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10015739m |
Family | CBM43 |
Protein Properties | Length: 107 Molecular Weight: 11923.4 Isoelectric Point: 4.1556 |
Chromosome | Chromosome/Scaffold: 3 Start: 9919021 End: 9919373 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 7 | 86 | 1.1e-29 |
WCVADPQIPDSVTQSALNWACQQGGVDCSTIQPNQPCFEPNTIKNHASVVFNNYYQILKHMGADCYFSSAAILTQRDPSN |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
KAEFGQWCVA DPQIPDSVTQ SALNWACQQG GVDCSTIQPN QPCFEPNTIK NHASVVFNNY 60 YQILKHMGAD CYFSSAAILT QRDPSNYLIS LINQDLDLLY VYDLMI* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-16 | 6 | 78 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-30 | 6 | 86 | 81 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 2e-32 | 1 | 87 | 25 | 111 | unknown [Populus trichocarpa] |
RefSeq | NP_001154494.1 | 2e-39 | 1 | 86 | 9 | 94 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 3.00018e-42 | 1 | 97 | 9 | 115 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002307902.1 | 2e-32 | 1 | 87 | 24 | 110 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 2e-32 | 2 | 86 | 24 | 108 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-18 | 5 | 85 | 11 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FS976917 | 85 | 2 | 86 | 6e-32 |
DT500003 | 87 | 1 | 87 | 8e-32 |
DK539002 | 87 | 1 | 86 | 8e-32 |
DK479406 | 87 | 1 | 86 | 8e-32 |
FG891416 | 85 | 2 | 86 | 8e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|