Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10016031m |
Family | CBM43 |
Protein Properties | Length: 68 Molecular Weight: 7455.35 Isoelectric Point: 8.3284 |
Chromosome | Chromosome/Scaffold: 3 Start: 9914377 End: 9914580 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 64 | 1.6e-23 |
RACHAGGADCSKIKPNQPCFEPNTIKDHASVVFNSYYQHYKHMGGSCYINGTAMITNYDPSK |
Full Sequence |
---|
Protein Sequence Length: 68 Download |
TERACHAGGA DCSKIKPNQP CFEPNTIKDH ASVVFNSYYQ HYKHMGGSCY INGTAMITNY 60 DPSKRLS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-10 | 4 | 56 | 58 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 6.0e-22 | 4 | 63 | 60 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 1e-22 | 2 | 64 | 48 | 110 | unknown [Populus trichocarpa] |
RefSeq | NP_001154494.1 | 1e-24 | 1 | 63 | 31 | 93 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 1e-26 | 1 | 66 | 31 | 96 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002269977.1 | 7e-23 | 4 | 64 | 1265 | 1325 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307902.1 | 1e-22 | 2 | 64 | 47 | 109 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000002 | 9 | 63 | 36 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DK457624 | 63 | 2 | 63 | 2e-24 |
EE429517 | 61 | 4 | 63 | 2e-24 |
DK539002 | 63 | 2 | 63 | 2e-24 |
DK479406 | 63 | 2 | 63 | 2e-24 |
DK517252 | 63 | 2 | 63 | 2e-24 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|