| Basic Information | |
|---|---|
| Species | Capsella rubella |
| Cazyme ID | Carubv10016195m |
| Family | GT1 |
| Protein Properties | Length: 159 Molecular Weight: 18194.2 Isoelectric Point: 7.4437 |
| Chromosome | Chromosome/Scaffold: 3 Start: 13019331 End: 13019918 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 8 | 133 | 4.3e-31 |
| RKDVEKILGEGFKDRIRECGMIVRDWVDQWEILSHESVKGFLSHCGWNSVQESICVGVPLLAWPMMAEQPLNAKMVVEEIKVGARVENVQGFVTREELSR KIKELMEEETGKIARKNVKEYSKMAK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 159 Download |
| VKFLWVTRKD VEKILGEGFK DRIRECGMIV RDWVDQWEIL SHESVKGFLS HCGWNSVQES 60 ICVGVPLLAW PMMAEQPLNA KMVVEEIKVG ARVENVQGFV TREELSRKIK ELMEEETGKI 120 ARKNVKEYSK MAKAALVEGT GSSWKNLDLI FKELNHFQ* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02534 | PLN02534 | 2.0e-34 | 3 | 158 | 175 | + UDP-glycosyltransferase | ||
| PLN02863 | PLN02863 | 2.0e-35 | 1 | 157 | 163 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
| PLN02992 | PLN02992 | 6.0e-36 | 6 | 157 | 153 | + coniferyl-alcohol glucosyltransferase | ||
| PLN03007 | PLN03007 | 2.0e-36 | 3 | 155 | 164 | + UDP-glucosyltransferase family protein | ||
| PLN02448 | PLN02448 | 2.0e-42 | 1 | 157 | 162 | + UDP-glycosyltransferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM62706.1 | 0 | 1 | 154 | 310 | 467 | putative glucosyltransferase [Arabidopsis thaliana] |
| EMBL | CAC01885.1 | 0 | 1 | 154 | 317 | 469 | glucosyltransferase-like protein [Arabidopsis thaliana] |
| RefSeq | NP_179281.3 | 0 | 1 | 154 | 310 | 467 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | NP_196990.2 | 0 | 1 | 154 | 317 | 475 | transferase, transferring glycosyl groups [Arabidopsis thaliana] |
| RefSeq | XP_002517353.1 | 0 | 1 | 155 | 307 | 463 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 1e-30 | 2 | 150 | 299 | 463 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2vch_A | 1e-30 | 2 | 150 | 299 | 463 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2vce_A | 1e-30 | 2 | 150 | 299 | 463 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2pq6_A | 1e-28 | 3 | 154 | 327 | 477 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c9z_A | 5e-26 | 1 | 153 | 301 | 453 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EV136204 | 158 | 1 | 154 | 0 |
| DR381096 | 153 | 6 | 154 | 0 |
| EH430204 | 158 | 1 | 154 | 0 |
| EH420035 | 158 | 1 | 154 | 0 |
| DK533875 | 158 | 1 | 154 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
