Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10021358m |
Family | CBM43 |
Protein Properties | Length: 110 Molecular Weight: 12050.8 Isoelectric Point: 6.2072 |
Chromosome | Chromosome/Scaffold: 2 Start: 8132451 End: 8132780 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 26 | 106 | 1.6e-29 |
WCVSDPSASEAQLQVNLDWLCGNLDCGIVKSGGSCYEPNTVASHASYMMNVYYQLNGATKEACYFTLSGRIIESNPSYGGC |
Full Sequence |
---|
Protein Sequence Length: 110 Download |
MFPRLTLIFF ISFFVIHSLH VSAKTWCVSD PSASEAQLQV NLDWLCGNLD CGIVKSGGSC 60 YEPNTVASHA SYMMNVYYQL NGATKEACYF TLSGRIIESN PSYGGCVYI* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-15 | 25 | 90 | 72 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-32 | 25 | 108 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001031243.1 | 2e-35 | 1 | 108 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001117561.1 | 3e-36 | 1 | 108 | 1 | 109 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118955.1 | 2e-25 | 3 | 108 | 7 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_176859.1 | 6.00036e-42 | 1 | 108 | 1 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_974558.1 | 9.80909e-45 | 1 | 108 | 1 | 110 | Expressed protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-22 | 22 | 108 | 9 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |