CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10021428m
FamilyGH1
Protein PropertiesLength: 521 Molecular Weight: 59841.7 Isoelectric Point: 7.3873
ChromosomeChromosome/Scaffold: 2 Start: 1369269 End: 1372250
Descriptionbeta-glucosidase 45
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1395140
  SPFPSDFLFGTASSAYQYEGAFLSEGKGLNNWDIFTHEYPGKIRDENNGDMAVDQYHRFMEDIDLMTSLGVNSYRFSISWSRVLPRGRFGSINYSGITYY
  NRLIDALISRGIKPFVTLNHFDYPQELENRFQSWLSPEMQKEFMYLADTCFKHFGDRVKLWITLNEPNQQITSSYLKGSFPPSRCSLPYGNCSQGNSETE
  PFIAAHNSILAHAKAVHLYRTKYQEEQKGIIGIVVQTSWFEPISDSIADKEAAERAQAFYSNWILDPVIHGKYPKEMVNLLGSALPRFSKKEVENLKESR
  SDFVGINHYTSYFIQDCLLSSCNNTGNGGSKVEGYALKLNRKGNVTIGELTDVVWQHIHPEGFRKMLNYLKDRYHNIPMFITENGFGDLQKPETTVKELL
  DDSKRVQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDNVTLKRTPKRSASWYRNYIGEN
Full Sequence
Protein Sequence     Length: 521     Download
MGNLAIFVFV ILVQISLMHN VYCSCLNQSS IENVLQGSSP FPSDFLFGTA SSAYQYEGAF    60
LSEGKGLNNW DIFTHEYPGK IRDENNGDMA VDQYHRFMED IDLMTSLGVN SYRFSISWSR    120
VLPRGRFGSI NYSGITYYNR LIDALISRGI KPFVTLNHFD YPQELENRFQ SWLSPEMQKE    180
FMYLADTCFK HFGDRVKLWI TLNEPNQQIT SSYLKGSFPP SRCSLPYGNC SQGNSETEPF    240
IAAHNSILAH AKAVHLYRTK YQEEQKGIIG IVVQTSWFEP ISDSIADKEA AERAQAFYSN    300
WILDPVIHGK YPKEMVNLLG SALPRFSKKE VENLKESRSD FVGINHYTSY FIQDCLLSSC    360
NNTGNGGSKV EGYALKLNRK GNVTIGELTD VVWQHIHPEG FRKMLNYLKD RYHNIPMFIT    420
ENGFGDLQKP ETTVKELLDD SKRVQYMSGY LDALQSAMRD GANVKGYFAW SLLDNFEWLY    480
GYKLRFGLYH VDNVTLKRTP KRSASWYRNY IGENLRRRYD * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029983.0e-12526515494+
PLN02814PLN028141.0e-13041511474+
COG2723BglB6.0e-14639514480+
TIGR03356BGL3.0e-15042507470+
pfam00232Glyco_hydro_18.0e-16840514480+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC28502.102451534519Similar to F4I1.26 putative beta-glucosidase gi
GenBankAAU05454.10985151417At1g61820 [Arabidopsis thaliana]
EMBLCBI23186.10351611521unnamed protein product [Vitis vinifera]
RefSeqNP_176374.1015181514BGLU45 (BETA-GLUCOSIDASE 45); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqNP_850968.1015151508BGLU46 (BETA GLUCOSIDASE 46); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A0255083483B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3gnp_A0255083483B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3gno_A0255083483A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B04151134503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A04151134503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX072146268653320
ES902608242903310
DK49310827182780
DK48155926482710
DK50094226382700
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)