Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10024927m |
Family | CBM43 |
Protein Properties | Length: 131 Molecular Weight: 14791.1 Isoelectric Point: 9.514 |
Chromosome | Chromosome/Scaffold: 4 Start: 13043742 End: 13044134 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 40 | 118 | 3.5e-25 |
WCVDNPYAHFTRVIWNLKRACENGADCSPMEKGRRCQDLDYYRSRASYAFNDYYQKNPTPRNCDFGGAAVLTIQDPSTS |
Full Sequence |
---|
Protein Sequence Length: 131 Download |
MKTRMLINLV VLISVARTAE AIGRLAAQQN TSIILTFTLW CVDNPYAHFT RVIWNLKRAC 60 ENGADCSPME KGRRCQDLDY YRSRASYAFN DYYQKNPTPR NCDFGGAAVL TIQDPSTSKP 120 LHICKNKIKL * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-11 | 39 | 109 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-23 | 39 | 118 | 81 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG38222.1 | 2e-18 | 40 | 119 | 104 | 183 | GPI-anchored protein [Zea mays] |
RefSeq | NP_001131448.1 | 4e-17 | 40 | 119 | 109 | 188 | hypothetical protein LOC100192780 [Zea mays] |
RefSeq | NP_001142053.1 | 2e-18 | 40 | 119 | 116 | 195 | hypothetical protein LOC100274209 [Zea mays] |
RefSeq | NP_181821.1 | 0 | 1 | 129 | 1 | 127 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002441577.1 | 9e-20 | 40 | 118 | 74 | 153 | hypothetical protein SORBIDRAFT_09g029700 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000002 | 40 | 116 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
Signal Peptide | |||||
---|---|---|---|---|---|
Cleavage Site | |||||
21 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CK195227 | 80 | 40 | 119 | 4e-21 |
BE358995 | 80 | 40 | 118 | 8e-20 |
FL921534 | 80 | 40 | 118 | 2e-19 |
CF445569 | 80 | 40 | 118 | 2e-18 |
DR971407 | 80 | 40 | 119 | 3e-18 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Arabidopsis lyrata | 903671 | ||||
Arabidopsis thaliana | AT2G42930.1 | ||||
Glycine max | Glyma15g23435.2 |