y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10026154m
FamilyGH77
Protein PropertiesLength: 575 Molecular Weight: 64082.6 Isoelectric Point: 6.3334
ChromosomeChromosome/Scaffold: 8 Start: 12299827 End: 12303966
Descriptiondisproportionating enzyme
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77865640
  LHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLLKDELPQPIDADCVNYQTANKLKSPLI
  TKAAKRLIGANGELKSKLQDFRNNPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYQSQKEFIDLFIAKQFLFQRQWQNVREYARGKG
  VDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSE
  AKVAMVGRWKVGPGKSLFDAISRGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQE
  EKSKAKKYLSIAGEEDISWSVIQAALSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDHLNSESYRL
Full Sequence
Protein Sequence     Length: 575     Download
MTMILSSSPS LSSLKLFRLS SPVSLSDAAF FRNRTKLSQS FRMEVVASSN STSLSSISVG    60
EDFPAEYEHW LPVPDPESRR RAGVLLHPTS FRGPHGIGDL GEEAFRFIDW LHSTGCSVWQ    120
VLPLVPPDEG GSPYAGQDAN CGNTLLISLD ELVKDGLLLK DELPQPIDAD CVNYQTANKL    180
KSPLITKAAK RLIGANGELK SKLQDFRNNP SISCWLEDAA YFAAIDNTLN AYSWFEWPEP    240
LKNRHLSALE AIYQSQKEFI DLFIAKQFLF QRQWQNVREY ARGKGVDIMG DMPIYVGYHS    300
ADVWANKKHF LLNKKGFPLL VSGVPPDLFS ETGQLWGSPL YDWKAMESDQ YSWWVNRIRR    360
AQDLYDECRI DHFRGFAGFW AVPSEAKVAM VGRWKVGPGK SLFDAISRGV GKIKIIAEDL    420
GVITKDVVEL RKSIGAPGMA VLQFAFGGGA DNPHLPHNHE VNQVVYSGTH DNDTIRGWWD    480
TLDQEEKSKA KKYLSIAGEE DISWSVIQAA LSSTAQTAII PMQDILGLGS SARMNTPATE    540
VGNWGWRIPS STSFDHLNSE SYRLKDLLSL YGRL*                               600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ2.0e-10879573506+
COG1640MalQ2.0e-13179573514+
PLN02635PLN02635060574519+
PRK14508PRK14508079574500+
pfam02446Glyco_hydro_77086571503+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21503.10557415585unnamed protein product [Vitis vinifera]
RefSeqNP_201291.101557418576DPE1 (DISPROPORTIONATING ENZYME); 4-alpha-glucanotransferase/ catalytic/ cation binding [Arabidopsis thaliana]
Swiss-ProtQ068010757415576DPEP_SOLTU RecName: Full=4-alpha-glucanotransferase, chloroplastic/amyloplastic; AltName: Full=Amylomaltase; AltName: Full=Disproportionating enzyme; Short=D-enzyme; Flags: Precursor
RefSeqXP_002276109.10557413583PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310024.10105746574predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A0585744524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp9_A0775562486A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp8_A0775562486A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB2owx_A0775565489A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB2oww_A0775565489A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO4350354791005730
ES8162152821093900
ES8050872982725690
FG5733452361994340
ES816215373874230.0000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)