CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10026761m
FamilyAA2
Protein PropertiesLength: 332 Molecular Weight: 35862 Isoelectric Point: 10.3118
ChromosomeChromosome/Scaffold: 8 Start: 12015613 End: 12017027
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2533140
  VRSVVQSHVRSNPANAPGLLRMHFHDCFVRGCDGSILLAGNASERTAGPNRSLRGFEVIDEAKTRLEAACPRTVSCADILTLATRDAVVLSGGQSWKVPL
  GRLDGRISQASDVNLPGPSDPVSKQKQDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFFNFNGTGQPDPSIDPSFVPLIQARCPQNGGTRVELDEGSV
  DRFDTSFLRKVRSSRVVLQSDLVLWKDTETRVIIERLLGLRRPSLKFGTEFGKSMVKMSLIE
Full Sequence
Protein Sequence     Length: 332     Download
MSRGYNFLCI LVTFSVLVAA VTAQGNRVSS RGGGRRPRVG FYGDRCRNVE SIVRSVVQSH    60
VRSNPANAPG LLRMHFHDCF VRGCDGSILL AGNASERTAG PNRSLRGFEV IDEAKTRLEA    120
ACPRTVSCAD ILTLATRDAV VLSGGQSWKV PLGRLDGRIS QASDVNLPGP SDPVSKQKQD    180
FAAKTLNTLD LVTLVGGHTI GTAGCGLVRG RFFNFNGTGQ PDPSIDPSFV PLIQARCPQN    240
GGTRVELDEG SVDRFDTSFL RKVRSSRVVL QSDLVLWKDT ETRVIIERLL GLRRPSLKFG    300
TEFGKSMVKM SLIEVKTGSD GEIRRVCSAI N* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like1.0e-2251311286+
pfam00141peroxidase4.0e-6653200150+
PLN03030PLN030303.0e-13741331296+
cd00693secretory_peroxidase3.0e-15341330296+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA64413.103833135332peroxidase precursor [Solanum lycopersicum]
EMBLCAG25463.103833135332cationic peroxidase [Solanum lycopersicum]
RefSeqNP_201215.1013311331peroxidase, putative [Arabidopsis thaliana]
RefSeqNP_201216.101033113330peroxidase, putative [Arabidopsis thaliana]
Swiss-ProtP2219603433129330PER2_ARAHY RecName: Full=Cationic peroxidase 2; AltName: Full=PNPC2; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0413317304A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB1pa2_A0413317304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3hdl_A0383313303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qgj_B0413316299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0413316299A Chain A, Arabidopsis Thaliana Peroxidase N
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG450183278413180
EG450170255412950
EG478894250833320
ES913415250853320
EG450170362973320.00000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00892.1Aquca_007_00386.1Aquca_007_00388.1Aquca_022_00275.1
Arabidopsis lyrata870602919714919715496608494031
329078316625316622351860920775
Arabidopsis thalianaAT2G41480.1AT5G64110.1AT5G39580.1AT5G64120.1AT5G64100.1
AT4G25980.1AT1G77100.1AT5G39580.2
Brachypodium distachyonBradi2g04490.1Bradi4g22660.1Bradi4g40680.1
Brassica rapaBra000228Bra016930Bra024268Bra031934Bra024269
Bra028436Bra024267Bra013938Bra031933Bra015695
Bra008291
Carica papayaevm.model.supercontig_42.86evm.model.supercontig_468.4evm.model.supercontig_468.3evm.model.supercontig_75.24evm.model.supercontig_49.72
evm.model.supercontig_42.87evm.TU.contig_36964.1evm.model.supercontig_845.4
Capsella rubellaCarubv10023605mCarubv10007711mCarubv10026774mCarubv10027924mCarubv10021650m
Carubv10007281m
Citrus clementinaCiclev10008925mCiclev10001751mCiclev10003869m
Citrus sinensisorange1.1g020511morange1.1g045530morange1.1g019638morange1.1g041705m
Cucumis sativusCucsa.217820.1Cucsa.292700.1Cucsa.217830.1Cucsa.345800.1Cucsa.292740.1
Cucsa.292700.2
Eucalyptus grandisEucgr.I02673.1Eucgr.L02460.2Eucgr.L02460.1Eucgr.L02460.4Eucgr.L02460.3
Eucgr.G00658.1Eucgr.F04267.1Eucgr.L01488.1Eucgr.L02460.6Eucgr.L02460.5
Fragaria vescamrna13503.1-v1.0-hybridmrna10707.1-v1.0-hybridmrna31037.1-v1.0-hybridmrna02015.1-v1.0-hybridmrna10709.1-v1.0-hybrid
mrna17058.1-v1.0-hybrid
Glycine maxGlyma08g19170.1Glyma13g23620.2Glyma06g28890.1Glyma15g05810.1Glyma15g05820.1
Glyma08g19180.1Glyma08g19340.1Glyma15g05650.1Glyma1655s00200.1Glyma15g05831.1
Gossypium raimondiiGorai.002G013000.1Gorai.012G141300.1Gorai.005G219200.1Gorai.005G219400.1Gorai.005G219100.1
Gorai.009G017700.2Gorai.009G017700.1Gorai.012G141500.1Gorai.012G141500.2Gorai.002G208800.1
Linum usitatissimumLus10007051Lus10012684Lus10007052Lus10020826Lus10015555
Lus10028631Lus10020421Lus10007050Lus10018929
Malus domesticaMDP0000298078MDP0000198353MDP0000184865MDP0000299137MDP0000515971
MDP0000684133MDP0000136412MDP0000493703MDP0000843352MDP0000527985
MDP0000139136
Manihot esculentacassava4.1_011950mcassava4.1_032385mcassava4.1_024068mcassava4.1_011945mcassava4.1_029449m
Medicago truncatulaMedtr4g114450.1Medtr4g114210.1Medtr2g008710.1Medtr2g008730.1Medtr2g008160.1
Medtr2g008710.2Medtr2g008160.2
Mimulus guttatusmgv1a009839mmgv1a023088mmgv1a019228mmgv1a018852m
Oryza sativaLOC_Os01g07770.1LOC_Os11g10460.1LOC_Os12g08920.1
Panicum virgatumPavirv00006707mPavirv00035647mPavirv00001257mPavirv00018071mPavirv00058650m
Pavirv00013421m
Physcomitrella patensPp1s22_167V6.1Pp1s22_159V6.1
Phaseolus vulgarisPhvul.006G207100.1Phvul.009G197100.1Phvul.003G164600.1Phvul.006G209100.1
Picea abiesMA_93867g0010MA_10426026g0010MA_10429595g0010MA_10434825g0010MA_9805677g0010
Populus trichocarpaPotri.006G069600.1Potri.018G131600.1Potri.016G125000.1
Prunus persicappa008723mppa008667m
Ricinus communis28320.m00113629989.m00043230174.m00915527985.m000888
Setaria italicaSi002216mSi026601mSi010572m
Selaginella moellendorffii10494613291523327112210075799
8986123609714593212686397402
13675973829123452
Sorghum bicolorSb03g004380.1Sb08g005520.1Sb05g009400.1
Thellungiella halophilaThhalv10016924mThhalv10004567mThhalv10004581mThhalv10004557mThhalv10019514m
Thhalv10025604m
Vitis viniferaGSVIVT01015537001GSVIVT01015533001.522.787GSVIVT01015533001.522.787GSVIVT01015533001.49.309GSVIVT01015533001.49.309
GSVIVT01029748001GSVIVT01029771001GSVIVT01029776001GSVIVT01029774001GSVIVT01029775001
GSVIVT01029773001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)