Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10027463m |
Family | CBM43 |
Protein Properties | Length: 83 Molecular Weight: 9002.76 Isoelectric Point: 3.9863 |
Chromosome | Chromosome/Scaffold: 8 Start: 11690833 End: 11691500 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 78 | 2.4e-30 |
TATDEQLQANIDYACSQNVDCSPIQPGGDCFNPNTLFDHASYVMNAYYQNHGRVDQGCGFQHTGCFVFADPSNGSC |
Full Sequence |
---|
Protein Sequence Length: 83 Download |
MSTATDEQLQ ANIDYACSQN VDCSPIQPGG DCFNPNTLFD HASYVMNAYY QNHGRVDQGC 60 GFQHTGCFVF ADPSNGSCVY YT* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 6.0e-17 | 2 | 66 | 70 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 2.0e-32 | 1 | 80 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAB10565.1 | 4e-26 | 1 | 63 | 30 | 92 | unnamed protein product [Arabidopsis thaliana] |
DDBJ | BAB10565.1 | 2e-39 | 1 | 82 | 97 | 178 | unnamed protein product [Arabidopsis thaliana] |
RefSeq | NP_001078788.1 | 7.00005e-41 | 1 | 82 | 29 | 110 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118954.1 | 1e-31 | 4 | 80 | 36 | 112 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_201128.2 | 5e-38 | 1 | 82 | 30 | 111 | unknown protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-23 | 5 | 78 | 21 | 94 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CD529194 | 83 | 1 | 83 | 4.00001e-40 |
CD533008 | 83 | 1 | 83 | 5e-40 |
CD531174 | 83 | 1 | 83 | 5e-40 |
AU239292 | 83 | 1 | 83 | 1e-39 |
BP821130 | 81 | 1 | 81 | 2e-39 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |