y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCapsella rubella
Cazyme IDCarubv10027738m
FamilyGH38
Protein PropertiesLength: 1033 Molecular Weight: 116068 Isoelectric Point: 6.9319
ChromosomeChromosome/Scaffold: 8 Start: 13276156 End: 13281781
DescriptionGlycosyl hydrolase family 38 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38433540
  NVHLVPHSHDDVGWLKTVDQYFVGSNNSIQNACVRNVLDSVVDSLLRDPNRKFVFGEMAFFTRWWEEQSPQTQEQVRRLVKSGQLEFVNGGWSMNDEATC
  HYIDMIDHTTMGHRFIKQHFNTTPRAAWQIDPFGHSSVQAYLLGAELGLDSLHFARIDYQDREKRKAEKSLEVIWRGSKTLASSSQIFTNVFLVHYGPPT
  GFHYEVSDDYVPLQDDPSSDGYNIKEAVDNFVNASMVYANVSRGNHVMWTMGDDFQYQFAESWFRQMDRLIHYVNKDGRVNALYSTPSLYVDAKNDANVT
  WPLKTDDFFPYA
Full Sequence
Protein Sequence     Length: 1033     Download
MAKPSLSLLK AAVCVIVSVL RLVNGGGYVK YGTEARVVPG KLNVHLVPHS HDDVGWLKTV    60
DQYFVGSNNS IQNACVRNVL DSVVDSLLRD PNRKFVFGEM AFFTRWWEEQ SPQTQEQVRR    120
LVKSGQLEFV NGGWSMNDEA TCHYIDMIDH TTMGHRFIKQ HFNTTPRAAW QIDPFGHSSV    180
QAYLLGAELG LDSLHFARID YQDREKRKAE KSLEVIWRGS KTLASSSQIF TNVFLVHYGP    240
PTGFHYEVSD DYVPLQDDPS SDGYNIKEAV DNFVNASMVY ANVSRGNHVM WTMGDDFQYQ    300
FAESWFRQMD RLIHYVNKDG RVNALYSTPS LYVDAKNDAN VTWPLKTDDF FPYADREYAY    360
WTGYFTSRPA LKRYVRALSG YYLAARQLEF LVGKKSGGPN TCSLADALGI AQHHDAVTGT    420
AKQHVTDDYM KRLAFGASEA EAVVNSALAC LLNKSPKGGC IKPTIAFSQC SLMNISYCPS    480
TEETISGQKS LILVAYNSLG WNRTEIIRIP VNDAGLSVED TSGNTLDAQY IPMDNVTSNL    540
RMFYTKAYLG KLSTQIPKYW LVFKATVPPL GWNTFYISKA STQGSSNHTH SSVLLNPVSS    600
TTEIGPGNLK MLFSSDSGLV QRMYNSRTGA DLMVNQNYFW YASNVGDAND PQVSGAYIFR    660
PNGSLAYPVS SFKPKLQIVQ GPLVDEVHQQ FSPWVAHVVR LYKDKEHAEF EFTIGPIPVN    720
NNDLMGKEII TRMVTDMSTD KAFYTDSNGR DFLKRVRDKR TDWPLQVNEP IAGNYYPLNL    780
GMYAKDEKAE FSVLVDRATG GASIKDGEIE LMLHRSTCMD DSRGVDESLV ETVCVNDTCA    840
GLTVRGSYYV SINKVGEGGR WRRETGQEIY SPLLMAFAQE NKEKWKASNT VKGYGMDPLY    900
TLPPNIALIT LEEMDLGNVL LRLAHLYEAG EDNDYSKLAK VELKKLFSGK MIKEVTEMNL    960
SANQEKAKMK EKMKWKVEGE AEEEEASSPL RGGPVDKSSF VVELGPMEIR TFVLQFSQKQ    1020
RRRRKLFVPN ML*                                                       1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like9.0e-7941365357+
pfam01074Glyco_hydro_386.0e-9343354316+
cd00451GH38N_AMII_euk9.0e-10942318277+
PLN02701PLN027011.0e-11041836887+
cd10810GH38N_AMII_LAM_like8.0e-17042318279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC66555.10311016271004hypothetical protein OsI_32713 [Oryza sativa Indica Group]
RefSeqNP_001064140.10311016271004Os10g0140200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_201416.101102811046glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
RefSeqXP_002265360.1011101681006PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303405.10121016181011predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ps3_A02683159884A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB1hxk_A02683129854A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A02683129854A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A02683129854A Chain A, Golgi Alpha-Mannosidase Ii
PDB3eju_A02683159884A Chain A, Golgi Alpha-Mannosidase Ii
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7800626073359360
FG2273945001916820
DY27950232373290
HO780062872493351e-25
HO780062234144361.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)