Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10028162m |
Family | CE8 |
Protein Properties | Length: 104 Molecular Weight: 11328.9 Isoelectric Point: 5.6075 |
Chromosome | Chromosome/Scaffold: 8 Start: 6744573 End: 6744884 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 5 | 103 | 1.4e-38 |
AAIDGDGFMAQDLCIRNMAGPEKGVAVALQVSGDQVVFYRCENYGYQDTLYAHSNKQSYQDCYITSIVDFICGKASAVFQYCHIEARKPIGAQSKVITA |
Full Sequence |
---|
Protein Sequence Length: 104 Download |
MVLFAAIDGD GFMAQDLCIR NMAGPEKGVA VALQVSGDQV VFYRCENYGY QDTLYAHSNK 60 QSYQDCYITS IVDFICGKAS AVFQYCHIEA RKPIGAQSKV ITA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02916 | PLN02916 | 4.0e-36 | 7 | 103 | 97 | + pectinesterase family protein | ||
PLN02314 | PLN02314 | 7.0e-37 | 6 | 103 | 98 | + pectinesterase | ||
PLN02301 | PLN02301 | 2.0e-39 | 6 | 103 | 98 | + pectinesterase/pectinesterase inhibitor | ||
PLN02488 | PLN02488 | 3.0e-42 | 6 | 103 | 98 | + probable pectinesterase/pectinesterase inhibitor | ||
pfam01095 | Pectinesterase | 5.0e-46 | 6 | 103 | 98 | + Pectinesterase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD50038.1 | 6e-40 | 4 | 103 | 152 | 251 | AC007980_3 Hypothetical protein [Arabidopsis thaliana] |
GenBank | AAF16638.1 | 2e-36 | 3 | 103 | 321 | 421 | AC011661_16 T23J18.25 [Arabidopsis thaliana] |
GenBank | AAF16649.1 | 6e-36 | 6 | 103 | 127 | 224 | AC011661_27 T23J18.3 [Arabidopsis thaliana] |
GenBank | ABK28786.1 | 1e-36 | 3 | 103 | 1 | 101 | pectinesterase family protein [Arabidopsis thaliana] |
RefSeq | NP_172604.1 | 3e-37 | 6 | 103 | 127 | 224 | pectinesterase family protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1xg2_A | 5e-28 | 9 | 103 | 89 | 183 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 1gq8_A | 2e-25 | 9 | 103 | 93 | 187 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 2ntq_B | 0.000000003 | 7 | 91 | 93 | 193 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 2ntq_A | 0.000000003 | 7 | 91 | 93 | 193 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 2ntp_B | 0.000000003 | 7 | 91 | 93 | 193 | A Chain A, Pectin Methylesterase From Carrot |