y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus clementina
Cazyme IDCiclev10001012m
FamilyGH37
Protein PropertiesLength: 478 Molecular Weight: 53866.1 Isoelectric Point: 8.7973
ChromosomeChromosome/Scaffold: 5 Start: 6028331 End: 6034400
Descriptiontrehalase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37844740
  DPKLYVDLSLKSNLSTTVTAFHKLPRNATGSVSIPDFKEFMHEYFDGAGNDLVYAEPPDFVPEPDGFLPKVKNPQVRAWALEVHALWKNLSRRVSCSVSE
  RPEFHTLLPLPGPVVIPGSRFREVYYWDSYWVIRGLLASKMYKTAKAIVTNLIYLIDTYGYVLNGARAYYTNRSQPPLLSAMVYDIYNRTGDLDLVKKAL
  PALLKEHQFWNSGIHKVNVQDNRGRNHTLSRYYAMWNKPRPESSTTDKVHASKLLNASEKEQFYRELASVAESGWDFSTRWMRNTSDFTTLAITSILPVD
  LNIFILKMELDIVSMAQIVGDNKTVESFLKSAQARKEAIDSVFWNEENGQWLDYWISNGTGSQECQRWKASNQNNNAFASNFVPIWIDLFN
Full Sequence
Protein Sequence     Length: 478     Download
MRTASFHSRS SNSNGNHPVS SFSLSLLFLL LASVSASGTV PKAMSKPATG NFDRGPVIPT    60
TPLVTFLEHV QETALATFGQ KDFDPKLYVD LSLKSNLSTT VTAFHKLPRN ATGSVSIPDF    120
KEFMHEYFDG AGNDLVYAEP PDFVPEPDGF LPKVKNPQVR AWALEVHALW KNLSRRVSCS    180
VSERPEFHTL LPLPGPVVIP GSRFREVYYW DSYWVIRGLL ASKMYKTAKA IVTNLIYLID    240
TYGYVLNGAR AYYTNRSQPP LLSAMVYDIY NRTGDLDLVK KALPALLKEH QFWNSGIHKV    300
NVQDNRGRNH TLSRYYAMWN KPRPESSTTD KVHASKLLNA SEKEQFYREL ASVAESGWDF    360
STRWMRNTSD FTTLAITSIL PVDLNIFILK MELDIVSMAQ IVGDNKTVES FLKSAQARKE    420
AIDSVFWNEE NGQWLDYWIS NGTGSQECQR WKASNQNNNA FASNFVPIWI DLFNSGL*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13270treF2.0e-46203437243+
PRK13271treA1.0e-49203437241+
COG1626TreA3.0e-59203437244+
pfam01204Trehalase3.0e-13983443365+
PLN02567PLN02567057476423+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002263698.105647512432PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303674.105747517436predicted protein [Populus trichocarpa]
RefSeqXP_002303675.105547515436predicted protein [Populus trichocarpa]
RefSeqXP_002518875.105547514435alpha,alpha-trehalase, putative [Ricinus communis]
RefSeqXP_002523413.105747516434alpha,alpha-trehalase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D015743780360A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2wyn_C015743780360A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2wyn_B015743780360A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2wyn_A015743780360A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2jjb_D015743780360A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Signal Peptide
Cleavage Site
36
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY759526254392920
CV70591626512650
DT571282294443370
EY7387842032734750
EY6660192671714360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001134mCiclev10000621m
Ciclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny