Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10013575m |
Family | AA7 |
Protein Properties | Length: 149 Molecular Weight: 16210.6 Isoelectric Point: 9.4468 |
Chromosome | Chromosome/Scaffold: 6 Start: 23835313 End: 23835759 |
Description | FAD-binding Berberine family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA7 | 28 | 142 | 9.8e-30 |
KPKSIFVLLHKSHVQAAVICTRKLGIHMRVRRRGHDYEGPFYASEIKTHFIVVDISDLRSINIDIKDSSAWIQEGSTTGEVYYKIAEKSNVHGFSAGYCT SIGIGGHITRGAYGP |
Full Sequence |
---|
Protein Sequence Length: 149 Download |
MSSFSSILNS TAQNIFQIFG AFTASLPKPK SIFVLLHKSH VQAAVICTRK LGIHMRVRRR 60 GHDYEGPFYA SEIKTHFIVV DISDLRSINI DIKDSSAWIQ EGSTTGEVYY KIAEKSNVHG 120 FSAGYCTSIG IGGHITRGAY GPIGCLSL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0277 | GlcD | 0.002 | 41 | 142 | 107 | + FAD/FMN-containing dehydrogenases [Energy production and conversion] | ||
pfam01565 | FAD_binding_4 | 9.0e-10 | 29 | 142 | 115 | + FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidises the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016491 | oxidoreductase activity |
GO:0050660 | flavin adenine dinucleotide binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002299030.1 | 0 | 2 | 141 | 32 | 167 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002299036.1 | 0 | 2 | 143 | 55 | 192 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002317089.1 | 0 | 2 | 141 | 55 | 190 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002326177.1 | 0 | 2 | 143 | 28 | 165 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002330563.1 | 0 | 2 | 143 | 28 | 166 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3vte_A | 7e-28 | 4 | 129 | 33 | 152 | A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa |
PDB | 4dns_B | 9e-27 | 3 | 129 | 33 | 155 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 4dns_A | 9e-27 | 3 | 129 | 33 | 155 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3fw9_A | 3e-21 | 2 | 129 | 23 | 144 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With (S)-Scoulerine |
PDB | 4ec3_A | 4e-21 | 2 | 129 | 29 | 150 | A Chain A, Structure Of Berberine Bridge Enzyme, H174a Variant In Complex With (S)-Reticuline |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FR616785 | 140 | 2 | 141 | 0 |
CF829567 | 142 | 2 | 143 | 0 |
CU510027 | 142 | 2 | 143 | 0 |
CF829569 | 142 | 2 | 143 | 0 |
FS271572 | 140 | 2 | 141 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|