y
Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10017622m |
Family | CBM43 |
Protein Properties | Length: 84 Molecular Weight: 9132.26 Isoelectric Point: 4.4094 |
Chromosome | Chromosome/Scaffold: 2 Start: 34925069 End: 34925384 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 78 | 1.5e-31 |
WCVAKPGSTDQMLQAGLDYACNHADCGPIQQGGSCFDPNTLVQHAAFAINIYYQSMGRHKWDCDFNDSALLSLTDP |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
MVWCVAKPGS TDQMLQAGLD YACNHADCGP IQQGGSCFDP NTLVQHAAFA INIYYQSMGR 60 HKWDCDFNDS ALLSLTDPIS YIT* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-19 | 3 | 71 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-31 | 3 | 78 | 77 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2JON | 4e-25 | 3 | 78 | 13 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
RefSeq | NP_001042566.1 | 5e-26 | 2 | 78 | 37 | 113 | Os01g0243700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002300017.1 | 1e-24 | 2 | 78 | 5 | 81 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 7e-25 | 2 | 78 | 31 | 107 | hypothetical protein RCOM_0633850 [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-27 | 3 | 78 | 13 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AW433299 | 77 | 3 | 78 | 1e-27 |
BF596574 | 77 | 3 | 78 | 1e-27 |
BE347427 | 77 | 3 | 78 | 1e-27 |
BE190383 | 77 | 3 | 78 | 1e-27 |
AW277728 | 77 | 3 | 78 | 2e-27 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|