Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10017980m |
Family | CBM43 |
Protein Properties | Length: 87 Molecular Weight: 9234.25 Isoelectric Point: 4.6995 |
Chromosome | Chromosome/Scaffold: 2 Start: 34926102 End: 34926362 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 79 | 5.5e-31 |
WCVAKPAPSDQLLQSNIDFACQKVDCSPITSGGACFDPNTLMHHASFAMNLYYQNNGKTAASCDFNNSGLIVAANDP |
Full Sequence |
---|
Protein Sequence Length: 87 Download |
RTWCVAKPAP SDQLLQSNID FACQKVDCSP ITSGGACFDP NTLMHHASFA MNLYYQNNGK 60 TAASCDFNNS GLIVAANDPS DNTFLS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-19 | 2 | 71 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-29 | 2 | 83 | 83 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_200172.1 | 2e-25 | 1 | 83 | 27 | 108 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_200173.1 | 3e-23 | 3 | 83 | 28 | 107 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002312098.1 | 5e-25 | 1 | 77 | 368 | 445 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 1e-27 | 1 | 77 | 132 | 208 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 3e-23 | 1 | 80 | 30 | 108 | hypothetical protein RCOM_0633850 [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-22 | 2 | 77 | 12 | 88 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE256344 | 77 | 1 | 77 | 1e-27 |
EE255611 | 77 | 1 | 77 | 6e-27 |
CK096425 | 81 | 1 | 80 | 5e-26 |
EE255611 | 80 | 1 | 80 | 1e-22 |
EE256344 | 45 | 36 | 80 | 0.000000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|