Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10017995m |
Family | CBM43 |
Protein Properties | Length: 88 Molecular Weight: 9619.71 Isoelectric Point: 4.4239 |
Chromosome | Chromosome/Scaffold: 2 Start: 34933814 End: 34934120 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 13 | 88 | 2.4e-27 |
WCVAKPGSGEYILQQNINYACNYVDCSPTHDGGSCFNPTTLINHASFAMNLYYQTSAKNTASCDFRNSGLVVVNDP |
Full Sequence |
---|
Protein Sequence Length: 88 Download |
MVTIINEFAE ATWCVAKPGS GEYILQQNIN YACNYVDCSP THDGGSCFNP TTLINHASFA 60 MNLYYQTSAK NTASCDFRNS GLVVVNDP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-15 | 12 | 81 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-26 | 12 | 88 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002300444.1 | 2e-27 | 10 | 88 | 29 | 107 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002333741.1 | 4e-26 | 10 | 88 | 1 | 79 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 2e-20 | 9 | 88 | 28 | 107 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 2e-31 | 12 | 88 | 133 | 209 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002528491.1 | 2e-27 | 6 | 88 | 27 | 109 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-19 | 9 | 88 | 9 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EY745502 | 70 | 10 | 79 | 3e-38 |
EE256344 | 77 | 12 | 88 | 2e-31 |
EE255611 | 77 | 12 | 88 | 9e-31 |
EY745502 | 80 | 9 | 88 | 1e-21 |
EE256344 | 48 | 41 | 88 | 0.00000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|