y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus clementina
Cazyme IDCiclev10022072m
FamilyGT31
Protein PropertiesLength: 230 Molecular Weight: 25778.9 Isoelectric Point: 6.4385
ChromosomeChromosome/Scaffold: 3 Start: 238938 End: 243369
DescriptionGalactosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3111700
  MRFVIGHSATAGGVLDRAIDAEDEQHKDFLRLNHIEGYHELSSKTQIYFSTAVAKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLG
  QKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID
Full Sequence
Protein Sequence     Length: 230     Download
MRFVIGHSAT AGGVLDRAID AEDEQHKDFL RLNHIEGYHE LSSKTQIYFS TAVAKWDADF    60
YIKVDDDVHV NLGMVGSTLA RHRSKPRVYI GCMKSGPVLG QKGVKYHEPE YWKFGEEGNK    120
YFRHATGQIY AISKDLATYI SVNRHILHRY ANEDVSLGSW FIGLDVEHID DRSLCCGTAP    180
DCEWKAQAGN PCAASFDWSC SGVCKSVERM GEVHQRCGEG DEAIWHTSF*               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01762Galactosyl_T4.0e-491172178+
PLN03193PLN031933.0e-1581229229+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_174569.101229171399galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002278708.101229177405PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300511.101229127355predicted protein [Populus trichocarpa]
RefSeqXP_002317052.101229171399predicted protein [Populus trichocarpa]
RefSeqXP_002518935.101229175403Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE63270122912290
ES83401123012300
DV15209923012300
ES80503223012300
EX38781823012300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00268.1Aquca_052_00007.5Aquca_052_00007.4Aquca_052_00007.2Aquca_052_00007.1
Aquca_119_00001.1Aquca_005_00031.4Aquca_005_00031.3Aquca_005_00031.2Aquca_052_00007.3
Aquca_005_00031.1Aquca_037_00268.2Aquca_014_00028.1Aquca_013_00208.9Aquca_013_00208.7
Aquca_013_00208.4Aquca_013_00208.3Aquca_013_00208.10Aquca_013_00208.5Aquca_013_00208.6
Aquca_089_00021.2Aquca_089_00021.1Aquca_013_00208.8Aquca_013_00208.2Aquca_013_00208.1
Aquca_013_00208.11
Arabidopsis lyrata476947311603473475492104902296
313884472435879419495407901160
491522891474
Arabidopsis thalianaAT1G77810.2AT1G77810.1AT1G05170.2AT1G05170.1AT1G32930.1
AT2G32430.1AT1G33430.1AT4G26940.1AT1G11730.1AT1G33430.2
AT1G22015.1AT5G53340.2AT5G53340.1AT4G26940.2AT4G32120.1
AT2G25300.1
Brachypodium distachyonBradi3g46390.1Bradi1g15590.1Bradi2g24700.1Bradi2g56700.1Bradi4g31890.1
Bradi3g04860.1Bradi1g32726.1Bradi3g13770.1Bradi3g34830.1Bradi1g47860.1
Bradi1g47860.2Bradi3g34830.2
Brassica rapaBra015654Bra023296Bra015395Bra010422Bra005595
Bra010198Bra031357Bra012302Bra019835Bra016393
Bra019081Bra022647Bra003064Bra007804Bra011324
Carica papayaevm.model.supercontig_37.101evm.model.supercontig_828.1evm.TU.contig_30133.1evm.model.supercontig_12.295evm.model.supercontig_152.19
evm.model.supercontig_87.79evm.model.supercontig_187.4evm.model.supercontig_3.36evm.model.supercontig_122.23
Capsella rubellaCarubv10021555mCarubv10009858mCarubv10009358mCarubv10023330mCarubv10011446m
Carubv10009427mCarubv10012254mCarubv10028370mCarubv10023545mCarubv10005329m
Carubv10005570m
Citrus clementinaCiclev10021252mCiclev10020627mCiclev10008974mCiclev10008486mCiclev10008439m
Ciclev10001410mCiclev10001364mCiclev10016077mCiclev10015443mCiclev10024512m
Ciclev10015822mCiclev10015441mCiclev10023591mCiclev10001882mCiclev10001880m
Ciclev10021436mCiclev10024325mCiclev10005350mCiclev10005349mCiclev10005228m
Ciclev10008816mCiclev10020783m
Citrus sinensisorange1.1g022275morange1.1g017533morange1.1g016121morange1.1g015683morange1.1g021312m
orange1.1g017688morange1.1g015471morange1.1g015419morange1.1g022071morange1.1g015562m
orange1.1g015521morange1.1g015407morange1.1g021108morange1.1g018257morange1.1g016036m
orange1.1g015962morange1.1g021105morange1.1g021079morange1.1g026972morange1.1g021371m
orange1.1g045376morange1.1g024633morange1.1g024623morange1.1g025192morange1.1g024690m
orange1.1g019371morange1.1g019358morange1.1g019355morange1.1g017892morange1.1g023951m
orange1.1g023904morange1.1g044720morange1.1g024278morange1.1g024244morange1.1g024236m
orange1.1g024273morange1.1g019083morange1.1g016756morange1.1g024324morange1.1g024861m
orange1.1g029327morange1.1g025375m
Cucumis sativusCucsa.193380.3Cucsa.193380.1Cucsa.060060.4Cucsa.060060.2Cucsa.060060.1
Cucsa.274640.2Cucsa.274640.1Cucsa.148570.1Cucsa.154570.1Cucsa.072690.1
Cucsa.237810.1Cucsa.045210.1Cucsa.085780.1Cucsa.193380.2Cucsa.201890.8
Cucsa.201890.7Cucsa.201890.4Cucsa.201890.3Cucsa.201890.2Cucsa.201890.1
Cucsa.162560.4Cucsa.162560.1Cucsa.162560.3Cucsa.162560.2Cucsa.201890.5
Eucalyptus grandisEucgr.F03473.2Eucgr.F03473.1Eucgr.D01657.1Eucgr.F03738.5Eucgr.F03738.4
Eucgr.F03738.3Eucgr.F03738.2Eucgr.F03738.1Eucgr.A01123.2Eucgr.A01123.1
Eucgr.F04094.1Eucgr.K00317.1Eucgr.C01711.2Eucgr.A01123.3Eucgr.C01711.1
Fragaria vescamrna23782.1-v1.0-hybridmrna02238.1-v1.0-hybridmrna03345.1-v1.0-hybridmrna01864.1-v1.0-hybridmrna19626.1-v1.0-hybrid
mrna31179.1-v1.0-hybridmrna11602.1-v1.0-hybridmrna13123.1-v1.0-hybridmrna32019.1-v1.0-hybrid
Glycine maxGlyma14g33700.1Glyma13g02420.1Glyma06g46230.1Glyma04g43340.2Glyma04g43340.1
Glyma12g10520.1Glyma06g11330.1Glyma13g38500.1Glyma12g31980.3Glyma12g31980.1
Glyma09g36830.1Glyma09g36830.2Glyma12g00530.3Glyma12g00530.2Glyma17g01660.1
Glyma07g39070.2Glyma06g12970.3Glyma06g12970.1Glyma04g41810.2Glyma04g41810.1
Glyma11g02170.1Glyma14g14000.2Glyma14g14000.1Glyma17g32180.1Glyma11g02170.2
Gossypium raimondiiGorai.008G260300.3Gorai.008G260300.2Gorai.008G260300.1Gorai.010G046600.3Gorai.010G046600.2
Gorai.010G046600.1Gorai.013G101400.3Gorai.013G101400.2Gorai.013G101400.1Gorai.009G178900.6
Gorai.009G178900.2Gorai.011G013600.3Gorai.011G013600.2Gorai.011G013600.1Gorai.002G089700.4
Gorai.002G089700.3Gorai.002G089700.2Gorai.002G089700.1Gorai.009G440200.5Gorai.009G440200.4
Gorai.009G440200.2Gorai.009G440200.1Gorai.009G242100.1Gorai.006G204700.3Gorai.006G204700.2
Gorai.004G268200.1Gorai.006G204700.1Gorai.008G260300.4Gorai.013G101400.4Gorai.009G178900.3
Gorai.009G178900.1Gorai.005G149400.1Gorai.006G208900.2Gorai.006G208900.1Gorai.008G260300.5
Gorai.003G156200.1Gorai.007G014300.3Gorai.007G014300.2Gorai.007G014300.1Gorai.003G156200.2
Gorai.009G178900.5Gorai.004G292900.1Gorai.009G440200.3Gorai.010G116400.1Gorai.006G208900.3
Gorai.003G156200.3Gorai.009G178900.4
Linum usitatissimumLus10033248Lus10008282Lus10006933Lus10015107Lus10024750
Lus10031567Lus10040062Lus10020042Lus10027185Lus10039657
Lus10021538Lus10006782Lus10014945Lus10033935Lus10032350
Lus10002079Lus10001920Lus10001954Lus10038830Lus10001148
Malus domesticaMDP0000240682MDP0000015509MDP0000035633MDP0000149719MDP0000218946
MDP0000149254MDP0000106455MDP0000261248MDP0000305586MDP0000208103
MDP0000308911MDP0000279453MDP0000239688MDP0000254082MDP0000189111
MDP0000295772
Manihot esculentacassava4.1_008981mcassava4.1_009223mcassava4.1_009122mcassava4.1_008975mcassava4.1_008889m
cassava4.1_008886mcassava4.1_020961mcassava4.1_008793mcassava4.1_009046mcassava4.1_023087m
cassava4.1_009765mcassava4.1_012092mcassava4.1_010843mcassava4.1_011127mcassava4.1_011052m
cassava4.1_026632m
Medicago truncatulaMedtr3g073370.2Medtr3g073370.1Medtr2g088270.1Medtr4g035490.1Medtr5g009700.1
Medtr3g090600.1
Mimulus guttatusmgv1a007764mmgv1a007777mmgv1a007633mmgv1a007611mmgv1a007546m
mgv1a010231mmgv1a007921mmgv1a007366mmgv1a007738mmgv1a022857m
mgv1a009438mmgv1a019923mmgv1a009462m
Oryza sativaLOC_Os02g35870.2LOC_Os02g35870.1LOC_Os03g38050.1LOC_Os05g35266.2LOC_Os05g35266.1
LOC_Os09g27950.1LOC_Os01g65590.1LOC_Os02g06840.2LOC_Os02g06840.1LOC_Os06g46570.1
LOC_Os05g35266.3LOC_Os08g02370.1LOC_Os06g46570.2LOC_Os06g08005.1LOC_Os06g07905.2
LOC_Os06g07905.1LOC_Os08g29710.1
Panicum virgatumPavirv00056263mPavirv00039040mPavirv00011841mPavirv00035055mPavirv00025409m
Pavirv00059983mPavirv00051384mPavirv00055546mPavirv00049885mPavirv00062381m
Pavirv00026047mPavirv00017954mPavirv00041862mPavirv00030978mPavirv00038080m
Pavirv00041360mPavirv00062245mPavirv00062244mPavirv00017057mPavirv00017056m
Pavirv00004705mPavirv00025430mPavirv00064281mPavirv00048231m
Physcomitrella patensPp1s14_287V6.1Pp1s263_32V6.1Pp1s313_21V6.2Pp1s313_21V6.1Pp1s34_154V6.1
Pp1s101_254V6.1Pp1s101_254V6.2Pp1s152_167V6.1
Phaseolus vulgarisPhvul.009G026100.1Phvul.008G168500.1Phvul.011G103400.1Phvul.003G079100.1Phvul.011G003800.1
Phvul.005G115300.1Phvul.002G162100.1Phvul.009G136600.1Phvul.008G159800.1Phvul.001G049900.1
Phvul.008G133000.1
Picea abiesMA_90472g0010MA_11862g0010MA_8772058g0010MA_4402g0010MA_95800g0010
MA_10431213g0010
Populus trichocarpaPotri.002G089800.5Potri.002G089800.4Potri.002G089800.3Potri.002G089800.2Potri.002G089800.1
Potri.001G450200.2Potri.001G450200.1Potri.014G153700.4Potri.014G153700.3Potri.014G153700.2
Potri.014G153700.1Potri.011G004200.2Potri.011G004200.1Potri.005G171400.3Potri.005G171400.2
Potri.005G171400.1Potri.004G013900.3Potri.004G013900.2Potri.004G013900.1Potri.002G228900.8
Potri.002G228900.7Potri.002G228900.6Potri.002G228900.5Potri.002G228900.4Potri.002G228900.3
Potri.002G228900.1Potri.011G151400.1Potri.019G067300.2Potri.019G067300.1Potri.001G450200.3
Potri.002G228900.2Potri.002G228900.9Potri.003G136000.4Potri.003G136000.3Potri.003G136000.2
Potri.003G136000.1Potri.015G023700.2Potri.015G023700.1Potri.006G257200.3Potri.006G257200.2
Potri.006G257200.1Potri.004G013900.4Potri.018G024500.1Potri.018G024500.2
Prunus persicappa006755mppa006589mppa006612mppa006585mppa006530m
ppa023844mppa006626mppa008209mppa008186mppa008155m
Ricinus communis30068.m00260229908.m00595130169.m00645729600.m00056029842.m003586
30064.m00047930190.m01078630169.m00655029848.m004592
Setaria italicaSi017427mSi024836mSi000109mSi030564mSi030109m
Si006587mSi036099mSi017574mSi017391mSi013912m
Si007976mSi014017mSi014098m
Selaginella moellendorffii23245726716442743223325065231
9757481097
Sorghum bicolorSb04g023470.1Sb02g026360.1Sb01g015960.1Sb03g041540.1Sb09g021080.1
Sb10g027290.1Sb04g004400.1Sb07g001590.1Sb10g005160.1Sb07g019420.1
Sb10g005140.1
Thellungiella halophilaThhalv10007787mThhalv10007803mThhalv10018693mThhalv10025360mThhalv10007836m
Thhalv10009382mThhalv10023983mThhalv10016736mThhalv10007904mThhalv10014038m
Thhalv10000224mThhalv10025629mThhalv10014381m
Vitis viniferaGSVIVT01008948001GSVIVT01037664001GSVIVT01022413001GSVIVT01019685001GSVIVT01012721001
GSVIVT01037121001GSVIVT01030428001GSVIVT01019479001GSVIVT01028724001GSVIVT01035952001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)