Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10029440m |
Family | AA2 |
Protein Properties | Length: 163 Molecular Weight: 17793.3 Isoelectric Point: 8.2132 |
Chromosome | Chromosome/Scaffold: 8 Start: 1054046 End: 1059088 |
Description | ascorbate peroxidase 3 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 24 | 162 | 0 |
LIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKIS PKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL |
Full Sequence |
---|
Protein Sequence Length: 163 Download |
MALPVVDTEY LKEIDKARRD LRALIAYKNC APIMLRLAWH DAGTYDVNTK TGGPNGSIRN 60 EEEYSHGSNN GLKIALDFCE EVKAKHPKIT YADLYQLAGV VAVEVTGGPT VDFVPGRKDS 120 KISPKEGRLP DAKRGAPHLR DIFYRMGLSD KDIVALSGGH TL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 7.0e-50 | 17 | 161 | 155 | + Peroxidase. | ||
PLN02364 | PLN02364 | 3.0e-65 | 4 | 162 | 160 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 4.0e-67 | 2 | 162 | 161 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 3.0e-96 | 4 | 162 | 163 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02608 | PLN02608 | 3.0e-129 | 1 | 162 | 162 | + L-ascorbate peroxidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB52954.1 | 0 | 1 | 162 | 1 | 162 | ascorbate peroxidase [Gossypium hirsutum] |
GenBank | ACT87980.1 | 0 | 1 | 162 | 1 | 162 | ascorbate peroxidase [Jatropha curcas] |
DDBJ | BAB64351.1 | 0 | 1 | 162 | 1 | 162 | peroxisomal ascorbate peroxidase [Cucurbita cv. Kurokawa Amakuri] |
RefSeq | XP_002312965.1 | 0 | 1 | 162 | 1 | 162 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002530823.1 | 0 | 1 | 162 | 1 | 162 | L-ascorbate peroxidase 1, cytosolic, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 2 | 162 | 3 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 2 | 162 | 3 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 2 | 162 | 3 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 2 | 162 | 3 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 0 | 4 | 162 | 5 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CX673706 | 162 | 1 | 162 | 0 |
CN185121 | 162 | 1 | 162 | 0 |
CN186398 | 162 | 1 | 162 | 0 |
EY771463 | 162 | 1 | 162 | 0 |
EY736343 | 162 | 1 | 162 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|