y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.002900.3
FamilyGT8
Protein PropertiesLength: 609 Molecular Weight: 69165.2 Isoelectric Point: 6.9832
ChromosomeChromosome/Scaffold: 00034 Start: 71170 End: 80067
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82915800
  CLSMQLTVEYFRIYSTKLELSQAEKYSDPTLNHYIIFSNNILASSVVINSTVSNSKESRNQVFHVLTDGQNYFAMNLWFLRNSYEEAAVEVINVEQLKLD
  DHENVTFVLPQEFRISFRTLTHSRTEYISMFSHLHYLLPEIFKNLDKVVVLEDDVIVQRDLSALWSLDMDGKVNGAAQCCHVRLGELKSILGENGYVQND
  CTWMSGLNVIDLAKWRELDLSQTFRSLVREGGSTDAVALRASLLTFQSLIYALDDSWSLYGLGHDYKLNVQDVENAATLHYNGYLKPWLE
Full Sequence
Protein Sequence     Length: 609     Download
MKGGGGGGSG ASAYGFPAKR RWRGLVIGVL GLVILSMLVP LVFLLGLYNG FHTAGYASDP    60
QNSKPGFQPS HVDDVIRKLG PTLPKDVFQK YAIEPKKETV DFIHESQEPK GLPPPKVDAL    120
PKHTHENSTK VGGRVQPTDR MTAVDESGKP CEWKFGSYCI WRQEHREVIK DSMVKKLKDQ    180
LFVARAYYPT IAKLPTQSQL TQEMKQNIQE LERVLSESTT DLDLPLQIEK KSLKMEATIA    240
KAKSFPVDCN NVDKKLRQIF DMTEDEANFH MKQSAFLFQL AVQTMPKSMH CLSMQLTVEY    300
FRIYSTKLEL SQAEKYSDPT LNHYIIFSNN ILASSVVINS TVSNSKESRN QVFHVLTDGQ    360
NYFAMNLWFL RNSYEEAAVE VINVEQLKLD DHENVTFVLP QEFRISFRTL THSRTEYISM    420
FSHLHYLLPE IFKNLDKVVV LEDDVIVQRD LSALWSLDMD GKVNGAAQCC HVRLGELKSI    480
LGENGYVQND CTWMSGLNVI DLAKWRELDL SQTFRSLVRE GGSTDAVALR ASLLTFQSLI    540
YALDDSWSLY GLGHDYKLNV QDVENAATLH YNGYLKPWLE LGIPKYKAYW KKFLDREDLF    600
 LSKCNINP*                                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_14.0e-80323595279+
PLN02718PLN027182.0e-101167606461+
PLN02910PLN029106.0e-103156607484+
PLN02829PLN028293.0e-108168608470+
PLN02769PLN02769016607624+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08312.1046073644Glycosyl transferase, family 8 [Medicago truncatula]
RefSeqNP_565893.104960845619GAUT7 (GALACTURONOSYLTRANSFERASE 7); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002264525.101260811613PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326255.1012660897590glycosyltransferase [Populus trichocarpa]
RefSeqXP_002519984.1014260798575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.00241657877252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB1g9r_A0.00241657877252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.00941657877252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Transmembrane Domains
StartEnd
2547
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2882353271795040
EE6085002701514190
EE6103532701544220
EX0499772331543860
GR0627812632134670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)